Polypeptide MELO3C019179P2

Accession: MELO3C019179P2

Name: MELO3C019179P2

Description: Similar to Transcription initiation factor IIB-2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SS44|TF2B2_ARATH)

Sequence:

>MELO3C019179P2 Similar to Transcription initiation factor IIB-2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SS44|TF2B2_ARATH)
MSDAFCSDCKRQTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVGGPTNPLLADGGLSTVIAKPN
GTTGEFLSSSLGRWQNRGSNPDRGLILAFKTIATMSDRLGLVATIKDRANEIYKRVEDQKSSRGRNQDALLAACLYIACR
QEDKPRTVKEICSVANGATKKEIGRAKEYIVKQLGLETGQSVEMGTIHAGDFMRRFCSNLGMNNQAVKAAQEAVQKSEEF
DIRRSPISIAAAVIYIITQLSDDKKPLKDISVATGVAEGTIRNSYKDLYPHVSKILPGWYAKEEDLKNLCSP*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: transcription regulator activity, zinc ion binding, protein binding, translation initiation factor activity.

cellular_component: cytoplasm, transcription factor complex.

biological_process: translational initiation, regulation of transcription, DNA-dependent, transcription initiation, DNA-dependent.

These properties come from reactome analysis


REACTOME_REACTION: Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_103685), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_82574), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_85925), RNA Polymerase II Promoter Opening: First Transition (REACT_93391), NTP Binds Active Site of RNA Polymerase II (REACT_80120), RNA Polymerase II Promoter Opening: First Transition (REACT_80107), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_100578), Fall Back to Closed Pre-initiation Complex (REACT_98220), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_88546), Formation of the closed pre-initiation complex (REACT_105039), Fall Back to Closed Pre-initiation Complex (REACT_86577), Formation of the closed pre-initiation complex (REACT_91116), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_99814), NTP Binds Active Site of RNA Polymerase II (REACT_106132).

biological_process: transcription from RNA polymerase II promoter, gene expression, transcription initiation from RNA polymerase II promoter.

REACTOME_PATHWAY: Formation and Maturation of mRNA Transcript (REACT_85219), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_98915), Transcription (REACT_93622), Gene Expression (REACT_91657), Formation and Maturation of mRNA Transcript (REACT_92291), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_28862), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_78187), RNA Polymerase II Transcription (REACT_89454), RNA Polymerase II Pre-transcription Events (REACT_91410), RNA Polymerase II Transcription (REACT_97471), RNA Polymerase II Transcription Initiation (REACT_105389), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_85257), Transcription (REACT_99758), Gene Expression (REACT_85241), RNA Polymerase II Transcription Initiation (REACT_88340), RNA Polymerase II Pre-transcription Events (REACT_99660).

These properties come from phylome analysis


molecular_function: transcription regulator activity, zinc ion binding, protein binding, translation initiation factor activity.

cellular_component: nucleus.

biological_process: regulation of transcription, DNA-dependent, transcription initiation, DNA-dependent.

These properties come from kegg analysis


molecular_function: general RNA polymerase II transcription factor activity.

COG: Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB (COG1405).

Locations

Located in CM3.5_scaffold00036 from 3746286 to 3752302.

This polypeptide in other databases

In PhylomeDB is Phy003ACPE_CUCME .

Related features