Polypeptide MELO3C019532P1
Accession: MELO3C019532P1
Name: MELO3C019532P1
Sequence:
>MELO3C019532P1 VFRQLDLPLERHISLCEEKGDIETVKQPWKILPSGHKIGTPEQLWYASSKILNLQEDIPVMNVFPNSYIPLFLKGSGKKQ QAKNLHRWQTKSCCGTRNYNYKTERVGLITKAQKHPDADSLYVKKLMWEIATSNCCERISQVHTN*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: electron carrier activity, ATP binding, methionine-tRNA ligase activity, tRNA binding.
cellular_component: cytoplasm.
biological_process: electron transport chain, methionyl-tRNA aminoacylation.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MCCD_CUCME .

