Polypeptide MELO3C019712P1
Accession: MELO3C019712P1
Name: MELO3C019712P1
Description: Similar to Predicted protein (Populus trichocarpa) (uniref90:UniRef90_A9P8K1)
Sequence:
>MELO3C019712P1 Similar to Predicted protein (Populus trichocarpa) (uniref90:UniRef90_A9P8K1) MYRVRKIPSLVDLCVNKAIDNIRFLGDVGETDIHLLERILPHCTVDQLMHVEKSSEGRDLTPVTDKLWKKFYERQFGKES TTTVIERMRQKRVAFRWIQLYEAKMQDIEKNESKAADRIKQSYLKENARKQSRQIQICSKVPPSSNKRSFGGSGYGYNVA NTKNKILKKAKIEVLQSQEMKNIKAWRRNAVQKSSDIPSTKKPMFPGRESASTSKNTSTHMAKRW*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Formation of elongin complex (REACT_29953), Resumption of elongation after recovery from pausing (REACT_79713), Addition of nucleotides leads to transcript elongation (REACT_107064), TFIIS-mediated recovery of elongation from arrest (REACT_102520), Abortive termination of elongation after arrest (REACT_98053), Pol II elongation complex moves on the template as transcript elongates (REACT_30038), Separation of elongating transcript from template (REACT_81515), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_83561).
biological_process: transcription from RNA polymerase II promoter, gene expression, transcription elongation from RNA polymerase II promoter.
REACTOME_PATHWAY: Pausing and recovery of elongation (REACT_83577), RNA Polymerase II Transcription (REACT_106213), Transcription (REACT_34268), Gene Expression (REACT_108313), RNA Polymerase II Pre-transcription Events (REACT_82104), Formation and Maturation of mRNA Transcript (REACT_32779), Elongation arrest and recovery (REACT_79615), RNA Polymerase II Transcription Elongation (REACT_87946).
These properties come from phylome analysis
molecular_function: RNA polymerase II transcription elongation factor activity.
cellular_component: transcription elongation factor complex, integral to membrane.
biological_process: RNA interference, determination of adult lifespan, transcription elongation from RNA polymerase II promoter, regulation of transcription, DNA-dependent.
These properties come from blast2go analysis
cellular_component: integral to membrane, nucleus.
biological_process: regulation of transcription, DNA-dependent.
This polypeptide in other databases
In PhylomeDB is Phy003AEIC_CUCME .