Polypeptide MELO3C019800P1

Accession: MELO3C019800P1

Name: MELO3C019800P1

Description: Similar to Ubiquitin-like protein 5 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FGZ9|UBL5_ARATH)

Sequence:

>MELO3C019800P1 Similar to Ubiquitin-like protein 5 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FGZ9|UBL5_ARATH)
MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRAEKIRIQKWYNIYKDHITLKDYEIHDGMGLELYYN*

Download fasta sequence.

Properties

These properties come from phylome analysis


molecular_function: protein tag, protein binding.

cellular_component: mating projection, cytoplasm, nucleus.

biological_process: locomotion, positive regulation of growth rate, growth, protein modification process, nematode larval development, cell morphogenesis involved in conjugation with cellular fusion, nuclear mRNA splicing, via spliceosome, reproduction.

Locations

Located in CM3.5_scaffold00040 from 238511 to 238732.

This polypeptide in other databases

In PhylomeDB is Phy003A2DE_CUCME .

Related features