Polypeptide MELO3C019879P1

Accession: MELO3C019879P1

Name: MELO3C019879P1

Description: Similar to Ribosomal protein S14, mitochondrial (Oenothera berteriana) (uniprot_sprot:sp|P14875|RT14_OENBE)

Sequence:

>MELO3C019879P1 Similar to Ribosomal protein S14, mitochondrial (Oenothera berteriana) (uniprot_sprot:sp|P14875|RT14_OENBE)
MSGDKRNILDNYRRQLAAKFEVKRNLFKAICNDPSLPKDVREEHRYKLSKLPRNSSFTRLRNRCIFTGRPRGVYQLFRMS
RIVFRELAKKGLVMGVKKASW*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: small subunit ribosomal protein S14 (K02954).

cellular_component: cytosolic small ribosomal subunit.

COG: Ribosomal protein S14 (COG0199).

These properties come from phylome analysis


molecular_function: structural constituent of ribosome.

cellular_component: ribosome.

biological_process: translation.

These properties come from blast2go analysis


molecular_function: 2 iron, 2 sulfur cluster binding, rRNA binding, oxidoreductase activity, electron carrier activity, iron ion binding, structural constituent of ribosome.

cellular_component: chloroplast, ribosome, mitochondrion.

biological_process: electron transport chain, translation, tricarboxylic acid cycle.

Locations

Located in CM3.5_scaffold00040 from 1170620 to 1170925.

This polypeptide in other databases

In PhylomeDB is Phy003AAQO_CUCME .

Related features