Polypeptide MELO3C019898P1
Accession: MELO3C019898P1
Name: MELO3C019898P1
Description: Similar to Vesicle-associated membrane protein 727 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9M376|VA727_ARATH)
Sequence:
>MELO3C019898P1 Similar to Vesicle-associated membrane protein 727 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9M376|VA727_ARATH) MSQKGLIYSFVAKGTVVLAEHTSFSGNFSTIAVQCLQRLPSNSSKCTYSCDGHTFNFLLDSGFVFLAVADESVGRNMPFV FLERVKDDFKQRYGSSIKDENPHPLADDEDDDDLFLDRFSVAYTLDREFGPRLKEHMQYCMSHPEEMSKLSKLKAQITEV KGIMMDNIEKVLDRGERIELLVDKTENLQFQADNFHRQGRQLRRKMWLQSLQMKLMVGGGILVLFIILWFIVCGGFKC*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Vamp And trans-Golgi Network AP-1 Binding Coupled With Cargo Capture (REACT_19391), trans-Golgi Network Coat Assembly (REACT_19334), trans-Golgi Network Derived Vesicle Uncoating (REACT_19124), Vamp7 associated Lysosome to Plasma membrane transport (REACT_14778), trans-Golgi Network Vesicle Scission (REACT_19255), Vamp8 associated secretory vesicle to plasma membrane transport (REACT_28160), trans-Golgi Network Lysosomal Vesicle Scission (REACT_19194), trans-Golgi Network Derived Lysosomal Vesicle Uncoating (REACT_19206), Recruitment Of Cytoplasmic Proteins To Vesicles (REACT_19237), Vamp And trans-Golgi Network AP-1 Binding Coupled With Cargo Capture On Lysosome Vesicle Destined Golgi Membrane (REACT_19371), trans-Golgi Network Lysosome Vesicle Destined Membrane Coat Assembly (REACT_19167), Vamp8 associated secretory vesicle to plasma membrane transport (REACT_110416).
biological_process: cellular membrane organization, post-Golgi vesicle-mediated transport.
REACTOME_COMPLEX: Cargo:AP-1:Beta-arrestin:Clathrin Triskelion:Vamp Complex [cytoplasmic vesicle membrane] (REACT_15080), Lysosome Cargo:AP-1:Beta-arrestin:Clathrin Triskelion:Vamp Complex [lysosomal membrane] (REACT_19609), Cargo:AP-1:beta-Arrestin-1:Vamp Complex [Golgi membrane] (REACT_19464), Cargo:AP-1:Arf1-GTP:beta-Arrestin-1:Vamp Complex [Golgi membrane] (REACT_20036), Lysosome Destined Cargo:AP-1:Beta-arrestin:Vamp:Clathrin Triskelion:Dynamin:Endophilin Complex [Golgi membrane] (REACT_20224), Cargo:AP-1:Beta-arrestin:Vamp:Clathrin Triskelion:Dynamin:Endophilin Complex [Golgi membrane] (REACT_14893), Vamp7:SNAP23:Syn4 Plasma membrane vesicle docking and fusion complex [plasma membrane, lysosomal membrane] (REACT_14917), Lysosome Destined Cargo:AP-1:beta-Arrestin-1:Vamp Complex [Golgi membrane] (REACT_19991), Lysosome Destined Cargo:AP-1:Arf1-GTP:beta-Arrestin-1:Vamp Complex [Golgi membrane] (REACT_19668).
REACTOME_PATHWAY: Clathrin derived vesicle budding (REACT_100038), Membrane Trafficking (REACT_86557), Golgi Associated Vesicle Biogenesis (REACT_19400), trans-Golgi Network Vesicle Budding (REACT_31900), Lysosome Vesicle Biogenesis (REACT_19287), trans-Golgi Network Vesicle Budding (REACT_31975), trans-Golgi Network Vesicle Budding (REACT_11235), Clathrin derived vesicle budding (REACT_19187), Membrane Trafficking (REACT_11123), Membrane Trafficking (REACT_83546), Clathrin derived vesicle budding (REACT_101182).
These properties come from phylome analysis
cellular_component: SNARE complex, endosome, integral to membrane.
biological_process: vacuole organization, protein targeting to vacuole, vesicle-mediated transport.
These properties come from blast2go analysis
cellular_component: cytoplasmic membrane-bounded vesicle, integral to membrane.
biological_process: vesicle-mediated transport.
This polypeptide in other databases
In PhylomeDB is Phy003AAHA_CUCME .