Polypeptide MELO3C019951P1

Accession: MELO3C019951P1

Name: MELO3C019951P1

Description: Similar to ATP synthase subunit alpha, mitochondrial (Beta vulgaris) (uniprot_sprot:sp|Q06735|ATPAM_BETVU)

Sequence:

>MELO3C019951P1 Similar to ATP synthase subunit alpha, mitochondrial (Beta vulgaris) (uniprot_sprot:sp|Q06735|ATPAM_BETVU)
MKQGCDSSKLVFVQYREVAAFAHFGSDLYAATQALLNRGSRLTEVSKQAQYAPLNIVKQILVIYAAVNGFCDRMPLERIS
QYERVIPSRIKPELQQSLLGGLTQEIKIELDAFLNESAFPFLSQRRNQT*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: proton-transporting ATPase activity, rotational mechanism, hydrogen ion transporting ATP synthase activity, rotational mechanism, zinc ion binding, poly(U) RNA binding, ATP binding.

cellular_component: mitochondrial proton-transporting ATP synthase complex, catalytic core F(1).

biological_process: plasma membrane ATP synthesis coupled proton transport.

These properties come from phylome analysis


molecular_function: hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, proton-transporting ATPase activity, rotational mechanism, hydrogen ion transporting ATP synthase activity, rotational mechanism, ATP binding.

cellular_component: proton-transporting ATP synthase complex, catalytic core F(1), proton-transporting two-sector ATPase complex, catalytic domain.

biological_process: ATP hydrolysis coupled proton transport, ATP synthesis coupled proton transport.

Locations

Located in CM3.5_scaffold00040 from 2174949 to 2175338.

This polypeptide in other databases

In PhylomeDB is Phy003MACH_CUCME .

Related features