Polypeptide MELO3C019956P2

Accession: MELO3C019956P2

Name: MELO3C019956P2

Description: Similar to Probable F-actin-capping protein subunit beta (Arabidopsis thaliana) (uniprot_sprot:sp|Q9M9G7|CAPZB_ARATH)

Sequence:

>MELO3C019956P2 Similar to Probable F-actin-capping protein subunit beta (Arabidopsis thaliana) (uniprot_sprot:sp|Q9M9G7|CAPZB_ARATH)
MWEDDEDSFVGCFLIKKDGSKTGHGRRGFLQEGAWDAIHVIEVRLEDEGTASYCLTSTVMLSLTTDNNAAGTFSLSGSIR
RQMKMKLSVAEGHLCNMGRMIEEMESKLRNSLDQVYFGKTKEMVCTLRPPSEVLHMKLPDK*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: actin binding.

cellular_component: F-actin capping protein complex, cytoplasm.

biological_process: wing disc development, regulation of actin filament length, regulation of lamellipodium assembly, cytoplasmic transport, nurse cell to oocyte, border follicle cell migration, actin filament organization.

These properties come from reactome analysis


biological_process: blood coagulation.

REACTOME_REACTION: F-actin capping protein binds to the barbed end of elongating F-actin (REACT_25135), LRRC16A binds F-actin capping protein (REACT_25319), F-actin capping protein is a heterodimer (REACT_25363).

REACTOME_COMPLEX: LRRC16A:F-actin capping protein [cytosol] (REACT_26939), F-actin capping protein:f-actin [cytosol] (REACT_26552), F-actin capping protein [cytosol] (REACT_26977).

REACTOME_PATHWAY: Factors involved in megakaryocyte development and platelet production (REACT_24970), Hemostasis (REACT_604).

These properties come from phylome analysis


molecular_function: actin filament binding, identical protein binding, actin binding.

cellular_component: WASH complex, mating projection tip, actin cortical patch, cellular bud tip, actin filament, cytosol, F-actin capping protein complex, cytoplasm.

biological_process: actin filament capping, barbed-end actin filament capping, hermaphrodite genitalia development, positive regulation of growth rate, growth, pronuclear migration, filamentous growth, actin cytoskeleton organization, body morphogenesis, embryo development ending in birth or egg hatching, blood coagulation, cellular component movement, nematode larval development, embryonic axis specification, wing disc development, regulation of lamellipodium assembly, cytoplasmic transport, nurse cell to oocyte, border follicle cell migration, actin filament organization.

These properties come from kegg analysis


KEGG_ORTHOLOGS: capping protein (actin filament) muscle Z-line, beta (K10365).

Locations

Located in CM3.5_scaffold00040 from 2222497 to 2224225.

This polypeptide in other databases

In PhylomeDB is Phy003MCTN_CUCME .

Related features