Polypeptide MELO3C020183P1

Accession: MELO3C020183P1

Name: MELO3C020183P1

Description: Similar to Elongation factor 1-gamma (Prunus avium PE=2 SV=1) (uniprot_sprot:sp|Q9FUM1|EF1G_PRUAV)

Sequence:

>MELO3C020183P1 Similar to Elongation factor 1-gamma (Prunus avium PE=2 SV=1) (uniprot_sprot:sp|Q9FUM1|EF1G_PRUAV)
MVLVLHAGKTNKNSFKALIAAEYNGVEVKVVPDFEMGVSNKTPEFIKMNPIGKVPVLETPNGPIFESNAIARYVARLKAD
SPLYGSFLIDYGHIEQWIEFASLEVDSNILTWFRPRMGRAAYLPPVEEAAIAALKRALGALNTHLASNTYLVGHSITLAD
IVMTCNLLLGFTKLMTKNFTSEFPHVERYFWTLVNQPNFKKVLGEVKQAESVLPVQSAKKPDDSSKPKDSNESKKEPKKE
AEKEKPRDVAGEGEDEAPKPKPKNPLDLLPPSKMILDEWKRLYSNTKTNFREVAIKGFWDMYDPEGYSLWFCDYKYNDEN
IVSFVTLNKVGGFLQRMDLARKYAFGKMLVIGSEPPFKVKGLWLFRGQEIPKFILDECYDMELYEWRKVDISDEVQKECV
NQMIEDQEPFEGEALLDAKCFK*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: translation elongation factor activity.

cellular_component: eukaryotic translation elongation factor 1 complex.

biological_process: translational elongation.

These properties come from reactome analysis


REACTOME_REACTION: Regeneration of eEF1A:GTP by eEF1B activity (REACT_101345), Regeneration of eEF1A:GTP by eEF1B activity (REACT_110552), Formation of eEF1B complex (REACT_1395), Formation of eEF1B complex (REACT_86774), Regeneration of eEF1A:GTP by eEF1B activity (REACT_80698), Regeneration of eEF1A:GTP by eEF1B activity (REACT_100221), Formation of eEF1B complex (REACT_94268), Formation of eEF1B complex (REACT_82763), Regeneration of eEF1A:GTP by eEF1B activity (REACT_67), Formation of eEF1B complex (REACT_104552).

REACTOME_PATHWAY: Eukaryotic Translation Elongation (REACT_93503), Gene Expression (REACT_85241), Eukaryotic Translation Elongation (REACT_1477), Translation (REACT_86996), Metabolism of proteins (REACT_91052), Gene Expression (REACT_71), Eukaryotic Translation Elongation (REACT_82124), Metabolism of proteins (REACT_85873), Gene Expression (REACT_98256), Translation (REACT_81833), Gene Expression (REACT_108313), Eukaryotic Translation Elongation (REACT_30678), Translation (REACT_100851), Gene Expression (REACT_91657), Metabolism of proteins (REACT_99179), Translation (REACT_1014), Metabolism of proteins (REACT_17015), Translation (REACT_105544), Eukaryotic Translation Elongation (REACT_108858), Metabolism of proteins (REACT_102155).

REACTOME_COMPLEX: eEF1B complex [cytosol] (REACT_3047), eEF1B:GDP exchange complex [cytosol] (REACT_3385).

biological_process: translation, gene expression, cellular protein metabolic process, translational elongation.

These properties come from kegg analysis


molecular_function: translation elongation factor activity.

Locations

Located in CM3.5_scaffold00041 from 3543551 to 3545817.

This polypeptide in other databases

In PhylomeDB is Phy003LLC8_CUCME .

Related features