Polypeptide MELO3C020213P1

Accession: MELO3C020213P1

Name: MELO3C020213P1

Description: Similar to Photosystem I P700 chlorophyll a apoprotein A1 (Fragment) (Encephalartos lebomboensis) (uniprot_sprot:sp|Q9MUK4|PSAA_ENCLE)

Sequence:

>MELO3C020213P1 Similar to Photosystem I P700 chlorophyll a apoprotein A1 (Fragment) (Encephalartos lebomboensis) (uniprot_sprot:sp|Q9MUK4|PSAA_ENCLE)
MWRASGITNELQLYCTAIGALVFAALMLFAGWFHYHKAAPKLAWFQNVESMLNHHLTGLQ*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: 4 iron, 4 sulfur cluster binding, chlorophyll binding, electron carrier activity, iron ion binding, magnesium ion binding.

cellular_component: integral to membrane, chloroplast thylakoid membrane, photosystem I.

biological_process: electron transport chain, protein-chromophore linkage, photosynthesis, transport.

Locations

Located in CM3.5_scaffold00042 from 748797 to 748979.

This polypeptide in other databases

In PhylomeDB is Phy003MBO4_CUCME .

Related features