Polypeptide MELO3C020230P1

Accession: MELO3C020230P1

Name: MELO3C020230P1

Description: Similar to Glutamine synthetase cytosolic isozyme (Lotus japonicus) (uniprot_sprot:sp|Q42899|GLNA1_LOTJA)

Sequence:

>MELO3C020230P1 Similar to Glutamine synthetase cytosolic isozyme (Lotus japonicus) (uniprot_sprot:sp|Q42899|GLNA1_LOTJA)
MSLLSDLINLNLSDSTEKIIAEYIWIGGSGMDLRSKARTLSGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYPQAIFRD
PFRRGNNILVICDAYTPAGEPIPTNKRHAAAKIFSHPDVVAEVPWYGIEQEYTLLQKDVKWPIGWPIGGFPGPQGPYYCG
VGVDKAFGRDIVDAHYKACLYAGVNISGINGEVMPGQWEFQVGPSVGISAGDELWVARYILERITEIAGVVLSFDPKPIQ
GDWNGAGAHTNYSTKSMREEGGYEVIKKAIEKLKLRHKEHIAAYGEGNERRLTGRHETADINTFSWGVANRGASVRVGRD
TEKEGKGYFEDRRPASNMDPYVVTSMVAETTILWKP*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: ATP binding, glutamate-ammonia ligase activity.

cellular_component: cytoplasm.

biological_process: nitrogen fixation, glutamine biosynthetic process.

These properties come from reactome analysis


REACTOME_REACTION: glutamate + NH4+ + ATP => glutamine + ADP + orthophosphate [GLUL] (REACT_34384), glutamate + NH4+ + ATP => glutamine + ADP + orthophosphate [GLUL] (REACT_39662), glutamate + NH4+ + ATP => glutamine + ADP + orthophosphate [GLUL] (REACT_1171), glutamate + NH4+ + ATP => glutamine + ADP + orthophosphate [GLUL] (REACT_104940).

REACTOME_PATHWAY: Neurotransmitter uptake and Metabolism In Glial Cells (REACT_29399), Synaptic Transmission (REACT_13685), Transmission across Chemical Synapses (REACT_13477), Transmission across Chemical Synapses (REACT_29683), Transmission across Chemical Synapses (REACT_105301), Metabolism of amino acids and derivatives (REACT_28699), Astrocytic Glutamate-Glutamine Uptake And Metabolism (REACT_106917), Synaptic Transmission (REACT_102748), Neurotransmitter uptake and Metabolism In Glial Cells (REACT_13594), Metabolism of amino acids and derivatives (REACT_13), Astrocytic Glutamate-Glutamine Uptake And Metabolism (REACT_13639), Amino acid synthesis and interconversion (transamination) (REACT_109330), Neurotransmitter uptake and Metabolism In Glial Cells (REACT_82534), Amino acid synthesis and interconversion (transamination) (REACT_101745), Transmission across Chemical Synapses (REACT_31284), Astrocytic Glutamate-Glutamine Uptake And Metabolism (REACT_82044), Metabolism of amino acids and derivatives (REACT_86268), Metabolism of amino acids and derivatives (REACT_29108), Synaptic Transmission (REACT_89785), Astrocytic Glutamate-Glutamine Uptake And Metabolism (REACT_102797), Amino acid synthesis and interconversion (transamination) (REACT_238), Neurotransmitter uptake and Metabolism In Glial Cells (REACT_97761), Amino acid synthesis and interconversion (transamination) (REACT_33022), Synaptic Transmission (REACT_29595).

REACTOME_COMPLEX: GLUL decamer [cytosol] (REACT_3307).

biological_process: cellular nitrogen compound metabolic process, synaptic transmission, cellular amino acid biosynthetic process, neurotransmitter uptake.

These properties come from kegg analysis


KEGG_REACTION: L-Glutamate:ammonia (R00253).

molecular_function: glutamate-ammonia ligase activity.

COG: Glutamine synthetase (COG0174).

Locations

Located in CM3.5_scaffold00042 from 1166558 to 1169442.

This polypeptide in other databases

In PhylomeDB is Phy003A735_CUCME .

Related features