Polypeptide MELO3C020331P1

Accession: MELO3C020331P1

Name: MELO3C020331P1

Description: Similar to NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (Solanum tuberosum PE=2 SV=1) (uniprot_sprot:sp|Q43644|NDUS1_SOLTU)

Sequence:

>MELO3C020331P1 Similar to NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (Solanum tuberosum PE=2 SV=1) (uniprot_sprot:sp|Q43644|NDUS1_SOLTU)
MGLGTLASRVVKPSSRLLTSRNPRNLLHFRPIFSTTELHNADASAAAQPQADPAPPPPPPRTPLAGARVHFSSPEDAIEV
FVDGYPVKVPKGMTVLQACEIAGVDIPRFCYHSRLSIAGNCRMCLVEVEKSPKPVASCAMPALPGMKIKTDTPLAKKARE
GVMEFLLMNHPLDCPICDQGGECDLQDQSMAFGSDRGRFTDVKRSVVDKNLGPLVKTVMTRCIQCTRCVRFATEVAGVQD
LGMLGRGSGEEIGTYVEKLMTSELSGNVIDICPVGALTSKPFAFKARNWELKGTETIDVTDAVGSNIRIDSRGPEVMRIV
PRLNEDINEEWISDKTRFCYDGLKRQRLNDPMIRGADGRFKAVSWRDALALVAEAAHHVKPEEIVGIAGKLSDAESMIAL
KDLLNRLGSNNVWCEGNGPQPNADLRSGYIMNTGIAGLEKADVFLLIGSQPKVEAAMINARIRKTVRATQAKVGYVGPPT
EFNYDHQHLGTGPQTLVDIVEGRHPFGSILKNAKNPAIIVGAGLFERNDKDAIFSVVENIAKQNNVVRPDWNGYNVLLLN
ASQAAALDLGLVPESVTSIESAKFVYLMGADDVELEKVPKDAFVVYQGHHGDRGVYRANVILPAAAFSEKDGTYENTEGC
AQQTLPAVPTVGDARDDWKIIRALSEVAGLQLPYDSLGAIRSRMKNVAPNLLQVDEREEATFSASIKPESTQKMDMADFG
SPIENFYMTDSITRASKIMAQCSALLSKK*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: 4 iron, 4 sulfur cluster binding, 2 iron, 2 sulfur cluster binding, electron carrier activity, NADH dehydrogenase (ubiquinone) activity, iron ion binding.

cellular_component: respiratory chain, chloroplast, mitochondrial inner membrane.

biological_process: ATP synthesis coupled electron transport, transport.

These properties come from reactome analysis


REACTOME_REACTION: NADH enters the respiratory chain at Complex I (REACT_98202), NADH enters the respiratory chain at Complex I (REACT_6310).

REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Respiratory electron transport (REACT_22393), Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_101166), Respiratory electron transport (REACT_30834).

REACTOME_COMPLEX: IP sub-complex [mitochondrial inner membrane] (REACT_6489), Complex I - 75 kDa subunit-2Fe-2S cluster-4Fe- 2 x 4S cluster complex [mitochondrial inner membrane] (REACT_6508), Complex I - NADH:Ubiquinone oxidoreductase [mitochondrial inner membrane] (REACT_6533).

biological_process: respiratory electron transport chain.

These properties come from phylome analysis


molecular_function: metal ion binding, transferase activity, protein binding, actin binding, 4 iron, 4 sulfur cluster binding, 2 iron, 2 sulfur cluster binding, electron carrier activity, NADH dehydrogenase (ubiquinone) activity.

cellular_component: membrane, mitochondrial intermembrane space, mitochondrial respiratory chain complex I, respiratory chain, chloroplast, mitochondrial inner membrane.

biological_process: reactive oxygen species metabolic process, regulation of mitochondrial membrane potential, ATP metabolic process, positive regulation of growth rate, growth, photorespiration, embryo development ending in birth or egg hatching, determination of adult lifespan, cytoskeleton organization, response to oxidative stress, apoptosis, oxygen and reactive oxygen species metabolic process (obsolete GO:0006800), mitochondrial electron transport, NADH to ubiquinone, nematode larval development, ATP synthesis coupled electron transport, transport.

These properties come from kegg analysis


KEGG_ORTHOLOGS: NADH dehydrogenase (ubiquinone) Fe-S protein 1 [EC:1.6.5.3 1.6.99.3] (K03934).

molecular_function: NADH dehydrogenase activity, NADH dehydrogenase (ubiquinone) activity.

Locations

Located in CM3.5_scaffold00042 from 3366578 to 3373239.

This polypeptide in other databases

In PhylomeDB is Phy003ACNE_CUCME .

Related features