Polypeptide MELO3C020439P1

Accession: MELO3C020439P1

Name: MELO3C020439P1

Description: Similar to Adenylyl cyclase-associated protein 1 (Homo sapiens) (uniprot_sprot:sp|Q01518|CAP1_HUMAN)

Sequence:

>MELO3C020439P1 Similar to Adenylyl cyclase-associated protein 1 (Homo sapiens) (uniprot_sprot:sp|Q01518|CAP1_HUMAN)
LRDYVKSFYPLGPVWTVTGKTTASSALKASPSPKTSAPGAPAPPPSPLASLFSSEPSQASSSKPKEGMAAVFQEINYGKP
VTLILKKVTDDMKTKNRADRVDIVGSSEKLGPTASPSFSKTGPSKLKLQMGRKWVVENQIGRKNLVIDDCDAKQSVYIFG
CKDSVLQIQGMVNNITVDKCTKLGVVFKDVVGAFEIVNSNGIEVQRPVLRSTLSFSHQIIF*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Recruitment of CAP to Abl (REACT_19260), Release of (inferred) platelet cytosolic components (REACT_21290).

REACTOME_PATHWAY: Signaling by Robo receptor (REACT_19351), Response to elevated platelet cytosolic Ca2+ (REACT_1280), Hemostasis (REACT_604), Platelet degranulation (REACT_318), Role of Abl in Robo-Slit signaling (REACT_19230), Platelet Activation (REACT_798), Formation of Platelet plug (REACT_20), Axon guidance (REACT_18266).

REACTOME_COMPLEX: CAP:Abl:Robo1:Slit2:Glypican-1 [plasma membrane] (REACT_20355).

biological_process: platelet activation, axon guidance, blood coagulation, platelet degranulation.

These properties come from blast2go analysis


molecular_function: actin binding.

biological_process: cytoskeleton organization.

Partial gene: true

Locations

Located in CM3.5_scaffold00043 from 2566104 to 2567186.

This polypeptide in other databases

In PhylomeDB is Phy003MF8V_CUCME .

Related features