Polypeptide MELO3C020545P1
Accession: MELO3C020545P1
Name: MELO3C020545P1
Description: Similar to Phosphoinositide phospholipase C 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q39033|PLCD2_ARATH)
Sequence:
>MELO3C020545P1 Similar to Phosphoinositide phospholipase C 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q39033|PLCD2_ARATH) MYKHSFKVCFFFSRRFRTNVAEAPEDVKRMFDKYSENGIMNIEQLQKFLNDVQGEDSRKAQVIFNNFKHLNFFQRRGLHL EEFFRYLLDQDLNLAFSPSHSAYQDMTAPLSHYYIFTGHNSYLTGNQLSSDCSETPIIRALKKGVRAIELDLWPNSKKNG VDVRHGGTLTAPVELVKCLRAIKDHAFTASKYPVIITFEDHLTHDLRQEVAEMLKSTFGSILYVPEPGEYLNEFPSPELL KGKILISTKPPERTTREKPPADESASSEEDIEGYMEELDKDEEIDIPEYESLIAIHAKKMKRGSDLRTLFNDMEKVLRLS LSEQKLEEAVSKYGHEIIRFTQRNLLRVYPKGSRFNSSNYNPMLGWTHGAQMVAFNMQVLEAGKYLWTMEGMFRGNGGCG YIKKPEFLLNNPKTSSSRSTPSQRIKGLKIKVYMGEGWHLEFDLSHFDFYSPPDLYVEIRMVGVGKDRATRKTIPIENQW VPVWNEEFSFSISTPELALLQIVVRDHDTSGKDDFAGQTCLPVKELQSGIRAVPLYNKRGERYKHVKLLMRFDFQK*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: phospholipase C activity.
biological_process: signal transduction.
These properties come from reactome analysis
REACTOME_REACTION: PIP2 hydrolysis (REACT_104013), Hydrolysis of 1-Phosphatidyl-D-myo-inositol 4,5-bisphosphate by Activated Phospholipase C Beta-1 (REACT_18383), Activation of PLC beta-1/4 (REACT_15402), PLC beta-mediated PIP2 hydrolysis (REACT_80473), Activation of PLC beta-1/4 (REACT_91086), Inactivation of PLC beta (REACT_87892), Activation of GRIK3 homomer (REACT_21309), PIP2 hydrolysis (REACT_87628), PLC beta is activated by G alpha (q) (REACT_97105), PLC beta is activated by G alpha (q) (REACT_81799), PIP2 hydrolysis (REACT_15353), Hydrolysis of 1-Phosphatidyl-D-myo-inositol 4,5-bisphosphate by Activated Phospholipase C Beta-1 (REACT_103548), Gbeta:gamma activation of PLC beta (REACT_19150), Activation of Phospholipase C Beta by Gq alpha (REACT_101999), PLC beta-mediated PIP2 hydrolysis (REACT_960), Inactivation of PLC beta (REACT_15301), PLC beta-mediated PIP2 hydrolysis (REACT_28636), Inactivation of PLC beta (REACT_31813), PLC beta is activated by G alpha (q) (REACT_19270), Activation of Phospholipase C Beta by Gq alpha (REACT_18418), PLC beta-mediated PIP2 hydrolysis (REACT_19319), Activation of PLC beta-1/4 (REACT_98277).
biological_process: synaptic transmission, regulation of insulin secretion, energy reserve metabolic process.
REACTOME_COMPLEX: Phospholipase C Beta: G(q) Complex [plasma membrane] (REACT_18449), Kainate receptor-glutamate-Gprotein complex [plasma membrane] (REACT_21842), G-protein beta-gamma:PLC beta 1/2/3 [plasma membrane] (REACT_19982), Activated PLC beta 1/4 [plasma membrane] (REACT_15568), PLC beta:G alpha (q/11) [plasma membrane] (REACT_17363).
REACTOME_PATHWAY: Neuroransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell (REACT_15370), G-protein mediated events (REACT_81829), Regulation of Insulin Secretion by Free Fatty Acids (REACT_29679), G beta:gamma signalling through PLC beta (REACT_19145), Diabetes pathways (REACT_106636), Signaling by GPCR (REACT_14797), PLC beta mediated events (REACT_30626), G alpha (q) signalling events (REACT_18283), PLC beta mediated events (REACT_15426), Regulation of Insulin Secretion by Acetylcholine (REACT_107231), G-protein mediated events (REACT_15526), Transmission across Chemical Synapses (REACT_13477), Regulation of Insulin Secretion by Acetylcholine (REACT_18405), Signaling by GPCR (REACT_92902), Regulation of Insulin Secretion (REACT_87602), GPCR downstream signaling (REACT_89233), G-protein beta:gamma signalling (REACT_19388), Opioid Signalling (REACT_106208), Opioid Signalling (REACT_15295), GPCR downstream signaling (REACT_19184), G alpha (q) signalling events (REACT_94531), Synaptic Transmission (REACT_13685), G-protein mediated events (REACT_99045), Regulation of Insulin Secretion by Fatty Acids Bound to GPR40 (FFAR1) (REACT_82398), G alpha (q) signalling events (REACT_78862), Regulation of Insulin Secretion by Free Fatty Acids (REACT_19375), Opioid Signalling (REACT_32504), PLC beta mediated events (REACT_80001), Signaling by GPCR (REACT_81368), Integration of energy metabolism (REACT_1505), GPCR downstream signaling (REACT_81307), Presynaptic function of Kainate receptors (REACT_21254), Diabetes pathways (REACT_15380), Activation of Kainate Receptors upon glutamate binding (REACT_21312), Regulation of Insulin Secretion (REACT_18325), Regulation of Insulin Secretion by Fatty Acids Bound to GPR40 (FFAR1) (REACT_19193), Integration of energy metabolism (REACT_89538).
These properties come from phylome analysis
molecular_function: calcium ion binding, signal transducer activity, phosphatidylinositol phospholipase C activity.
biological_process: intracellular signal transduction, lipid metabolic process.
These properties come from kegg analysis
KEGG_REACTION: 1-Phosphatidyl-1D-myo-inositol-4,5-bisphosphate (R03435).
molecular_function: phosphatidylinositol phospholipase C activity.
This polypeptide in other databases
In PhylomeDB is Phy003MJS9_CUCME .
