Polypeptide MELO3C020586P1
Accession: MELO3C020586P1
Name: MELO3C020586P1
Description: Similar to Mitochondrial import inner membrane translocase subunit Tim10 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9ZW33|TIM10_ARATH)
Sequence:
>MELO3C020586P1 Similar to Mitochondrial import inner membrane translocase subunit Tim10 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9ZW33|TIM10_ARATH) MASPNNMPSAVDKEQIFGMAEKEMEYRVELFNKLTQSCFNKCVDKRYKESELNMGENSCIDRCVSKYWHVTNLIGQLLGS GRPPM*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity, zinc ion binding.
cellular_component: mitochondrial intermembrane space protein transporter complex, mitochondrial inner membrane.
biological_process: transmembrane transport, protein import into mitochondrial inner membrane.
These properties come from phylome analysis
molecular_function: unfolded protein binding, metal ion binding, protein transporter activity, protein binding, zinc ion binding.
cellular_component: mitochondrial inner membrane protein insertion complex, mitochondrial inner membrane presequence translocase complex, mitochondrial intermembrane space protein transporter complex, mitochondrial inner membrane.
biological_process: hermaphrodite genitalia development, positive regulation of multicellular organism growth, locomotion, growth, embryo development ending in birth or egg hatching, sensory perception of sound, transmembrane transport, protein import into mitochondrial inner membrane.
This polypeptide in other databases
In PhylomeDB is Phy0039ZX7_CUCME .
