Polypeptide MELO3C020586P1

Accession: MELO3C020586P1

Name: MELO3C020586P1

Description: Similar to Mitochondrial import inner membrane translocase subunit Tim10 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9ZW33|TIM10_ARATH)

Sequence:

>MELO3C020586P1 Similar to Mitochondrial import inner membrane translocase subunit Tim10 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9ZW33|TIM10_ARATH)
MASPNNMPSAVDKEQIFGMAEKEMEYRVELFNKLTQSCFNKCVDKRYKESELNMGENSCIDRCVSKYWHVTNLIGQLLGS
GRPPM*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity, zinc ion binding.

cellular_component: mitochondrial intermembrane space protein transporter complex, mitochondrial inner membrane.

biological_process: transmembrane transport, protein import into mitochondrial inner membrane.

These properties come from phylome analysis


molecular_function: unfolded protein binding, metal ion binding, protein transporter activity, protein binding, zinc ion binding.

cellular_component: mitochondrial inner membrane protein insertion complex, mitochondrial inner membrane presequence translocase complex, mitochondrial intermembrane space protein transporter complex, mitochondrial inner membrane.

biological_process: hermaphrodite genitalia development, positive regulation of multicellular organism growth, locomotion, growth, embryo development ending in birth or egg hatching, sensory perception of sound, transmembrane transport, protein import into mitochondrial inner membrane.

Locations

Located in CM3.5_scaffold00044 from 1260292 to 1262344.

This polypeptide in other databases

In PhylomeDB is Phy0039ZX7_CUCME .

Related features