Polypeptide MELO3C020837P1
Accession: MELO3C020837P1
Name: MELO3C020837P1
Description: Similar to Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' beta isoform (Arabidopsis thaliana) (uniprot_sprot:sp|O04376|2A5B_ARATH)
Sequence:
>MELO3C020837P1 Similar to Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' beta isoform (Arabidopsis thaliana) (uniprot_sprot:sp|O04376|2A5B_ARATH) MGAQTNTQRSFSNLSKSLPTLKHLFDHDPFTNKPFGLTNIALQDEILSMVSFCSSMALSTTSHELKRFKLTHLFTVIKTS KKPLHHDVLSSVMSLISVNIFRPLPPPSPAFPITSTLAEENEVVVSSTLPSLNWLLLELVYEILLWLVINIDTQTLEKHI DHTFLLGLLSLFDSEEAKERESLKNVFHQIYYKLTKYRSFMRKAMSGVFLEYIFETERHNGIAEMLEIWGSIINGFAVPL KEEHKVFLKRILIPLHKVKGMQNFNKQLGYCVYQFVEKESELGGFIVRKIMKYWPQANSQKEIKLIEELEDLVEKLDPKL YRDLALPFCSHMTKCFKSLNSMVAERSLYMWSSEAFVTMVSTAMEEVFPVILRGMENIIRSHWNENVKELARNVKVILQE MNPILYHKTLHQNRSKQFKATQINRL*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Dephosphorylation of pChREBP (Ser 568) by PP2A (REACT_814), CTLA-4 binds B7-1/B7-2 (REACT_19129), Association of beta-catenin with the SCF-beta-TrCP1 ubiquitin ligase complex (REACT_9977), ERKs are inactivated by protein phosphatase 2A (REACT_12539), Kinetochore capture of astral microtubules (REACT_14798), Dissociation of beta-catenin from Axin and association of beta catenin with phospho-(20 aa) APC in the detruction complex (REACT_10127), Phosphorylation of beta-catenin at Ser45 by CK1 alpha (REACT_9978), Dephosphorylation of pChREBP (Thr 666) by PP2A (REACT_382), Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_10082), Dephosphorylation of pChREBP (Ser 196) by PP2A (REACT_1416), Phosphorylation of CTLA-4 (REACT_19380), PP2A binds CTLA4 homodimer (REACT_19404), Phosphoryation of phospho- (Ser45, Thr41) beta-catenin at Ser37 by GSK-3 (REACT_9959), Phosphorylation of phospho-(Ser45,Thr41,Ser37) at Ser33 by GSK-3 (REACT_9987), Dephosphorylation of phosphoPFKFB1 by PP2A complex (REACT_1347), Phosphorylation of APC component of the destruction complex (REACT_9983), Dephosphorylation of AKT by PP2A (REACT_19209), Assembly of the destruction complex (REACT_10134), Activation of PP2A by Xylulose-5-phosphate (REACT_2177), Association of beta-catenin with the destruction complex (REACT_10111), DARPP-32 is dephosphorylated on Thr75 by PP2A (REACT_15438), Phosphorylation of phospho-(Ser45 ) at Thr 41 by GSK-3 (REACT_9955), PECAM-1 binds PP2A (REACT_23942).
biological_process: glucose metabolic process, carbohydrate metabolic process, MyD88-independent toll-like receptor signaling pathway, MyD88-dependent toll-like receptor signaling pathway, platelet activation, mitotic prometaphase, toll-like receptor 4 signaling pathway, stress-activated MAPK cascade, toll-like receptor signaling pathway, innate immune response, mitotic cell cycle, T cell costimulation, nerve growth factor receptor signaling pathway, energy reserve metabolic process, M phase of mitotic cell cycle, glycolysis, toll-like receptor 3 signaling pathway, Toll signaling pathway, toll-like receptor 1 signaling pathway, blood coagulation, toll-like receptor 2 signaling pathway.
REACTOME_COMPLEX: phospho-(Ser45, Thr41) beta-catenin:Axin:GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10844), Axin:GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10218), PP2A [cytosol] (REACT_10628), SCF-beta-TrCP1 complex associated with phosphorylated beta-catenin [cytosol] (REACT_10593), Microtubule-bound kinetochore [cytosol] (REACT_15175), PP2A-ABdeltaC complex [nucleoplasm] (REACT_2369), ubiquitinated phospho-beta-catenin:SCF:beta-TrCP1 complex [cytosol] (REACT_10202), p-PECAM:PP2A [plasma membrane] (REACT_24470), phospho-(Ser45, Thr41, Ser37) beta-catenin:Axin,GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10861), Kinetochore [cytosol] (REACT_14970), Phospho-(Ser45, Thr41, Ser37, Ser33) beta-catenin:Axin:GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10610), phospho-(Ser45,Thr41,Ser37,Ser33):Axin:CK1alpha:GSK3B:phospho-APC (20 aa repeat region):PP2A complex [cytosol] (REACT_10886), PP2A:CTLA4:B7-1/B7-2 [plasma membrane] (REACT_19452), beta-catenin:Axin:GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10837), PP2A-ABdeltaC complex [cytosol] (REACT_5648), CTLA-4:PP2A [plasma membrane] (REACT_19731), phospho-(Ser45) beta-catenin:Axin:GSK3:CK1alpha:APC:PP2A complex [cytosol] (REACT_10809), phospho-(Ser45,Thr41,Ser37,Ser33):Axin:CK1alpha:GSK3B:phospho-APC (20 aa repeat region):PP2A complex [cytosol] (REACT_10381), Inactive PP2A-ABdeltaC complex [cytosol] (REACT_4092), phospho-(Ser45,Thr41,Ser37,Ser33):Axin:CK1alpha:GSK3B:phospho-APC (20 aa repeat region):PP2A complex [cytosol] (REACT_10660).
REACTOME_PATHWAY: Nuclear Events (kinase and transcription factor activation) (REACT_12433), M Phase (REACT_910), ERKs are inactivated (REACT_12436), Toll Like Receptor 9 (TLR9) Cascade (REACT_9047), DARPP-32 events (REACT_15334), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_6782), Costimulation by the CD28 family (REACT_19344), Hemostasis (REACT_604), PP2A-mediated dephosphorylation of key metabolic factors (REACT_705), DNA Replication (REACT_383), Toll Like Receptor 5 (TLR5) Cascade (REACT_9061), ERK/MAPK targets (REACT_12599), Metabolism of carbohydrates (REACT_474), MyD88 dependent cascade initiated on endosome (REACT_25222), Mitotic Prometaphase (REACT_682), CTLA4 inhibitory signaling (REACT_19405), Cell Cycle, Mitotic (REACT_152), Mitotic M-M/G1 phases (REACT_21300), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_25024), Platelet homeostasis (REACT_23876), Toll Like Receptor 2 Cascade (REACT_7980), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_9020), Toll Like Receptor 10 (TLR10) Cascade (REACT_9027), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_21328), Platelet sensitization by LDL (REACT_23879), Toll Like Receptor TLR1:TLR2 Cascade (REACT_8005), Toll Like Receptor 3 (TLR3) Cascade (REACT_6783), Adaptive Immunity Signaling (REACT_75774), Toll Receptor Cascades (REACT_6966), MyD88:Mal cascade initiated on plasma membrane (REACT_6788), Toll Like Receptor 4 (TLR4) Cascade (REACT_6894), Platelet Activation (REACT_798), Immune System (REACT_6900), Activated TLR4 signalling (REACT_6890), MAP kinase activation in TLR cascade (REACT_21308), Glycolysis (REACT_1383), MyD88 cascade initiated on plasma membrane (REACT_27215), Integration of energy metabolism (REACT_1505), Opioid Signalling (REACT_15295), MyD88-independent cascade initiated on plasma membrane (REACT_6809), NGF signalling via TRKA from the plasma membrane (REACT_12056), Glucose metabolism (REACT_723), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_25281), Toll Like Receptor TLR6:TLR2 Cascade (REACT_8006), Innate Immunity Signaling (REACT_6802), Signaling by Wnt (REACT_11045), Signalling by NGF (REACT_11061), Degradation of beta-catenin by the destruction complex (REACT_11063), Beta-catenin phosphorylation cascade (REACT_11065), Formation of Platelet plug (REACT_20).
These properties come from phylome analysis
molecular_function: amino acid transmembrane transporter activity, protein phosphatase type 2A regulator activity, binding.
cellular_component: integral to membrane, protein phosphatase type 2A complex.
biological_process: signal transduction.
These properties come from blast2go analysis
cellular_component: cell part.
biological_process: establishment of localization in cell, protein transport.
This polypeptide in other databases
In PhylomeDB is Phy003A2MR_CUCME .

