Polypeptide MELO3C020899P2
Accession: MELO3C020899P2
Name: MELO3C020899P2
Description: Similar to Probable calcium-binding protein CML20 (Arabidopsis thaliana) (uniprot_sprot:sp|O82659|CML20_ARATH)
Sequence:
>MELO3C020899P2 Similar to Probable calcium-binding protein CML20 (Arabidopsis thaliana) (uniprot_sprot:sp|O82659|CML20_ARATH) MASLYRGVSRKEKPKGRHGLTPQKKQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIRQMIADVDKDGSGAID YDEFEYMMTAKIGERDTKEELTKAFDIIDYDKNGKISGNDIKRIAKELGEVFTDKDIQEMIDEADRDRDGEVNVDDFFRM MRRTTYGS*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Recruitment of additional gamma tubulin/ gamma TuRC to the centrosome (REACT_15467), Loss of C-Nap-1 from centrosomes (REACT_15313), Recruitment of CDK11p58 to the centrosomes (REACT_15401), Dissociation of Phospho-Nlp from the centrosome (REACT_15440), Recruitment of Plk1 to centrosomes (REACT_15470), Plk1-mediated phosphorylation of Nlp (REACT_15386).
biological_process: G2/M transition of mitotic cell cycle, mitotic cell cycle.
REACTOME_COMPLEX: Mature centrosomes enriched in gamma-TURC complexes [cytosol] (REACT_15605), centrosome containing phosphorylated Nlp [cytosol] (REACT_17093), cNAP-1 depleted centrosome [cytosol] (REACT_17186), Centrosomes containing recruited CDK11p58 [cytosol] (REACT_17657), Centrosome associated Plk1 [cytosol] (REACT_18209), Nlp-depleted centrosome [cytosol] (REACT_18075), centrosome [cytosol] (REACT_15979).
REACTOME_PATHWAY: Loss of Nlp from mitotic centrosomes (REACT_15364), Cell Cycle, Mitotic (REACT_152), Mitotic G2-G2/M phases (REACT_21391), Recruitment of mitotic centrosome proteins and complexes (REACT_15296), Loss of proteins required for interphase microtubule organization from the centrosome (REACT_15451), G2/M Transition (REACT_2203), Centrosome maturation (REACT_15479).
These properties come from phylome analysis
molecular_function: identical protein binding, protein binding, structural constituent of cytoskeleton, 2-alkenal reductase activity, ATP-dependent helicase activity, ATP binding, calcium ion binding, nucleic acid binding.
cellular_component: transcription export complex 2, half bridge of spindle pole body, nuclear pore, plasma membrane.
biological_process: transmembrane transport, mRNA transport, proteasomal ubiquitin-dependent protein catabolic process, protein transport, spindle pole body duplication in nuclear envelope, microtubule nucleation, oxidation-reduction process, cell division, mitosis.
These properties come from blast2go analysis
molecular_function: 2-alkenal reductase activity, ATP-dependent helicase activity, ATP binding, calcium ion binding, nucleic acid binding.
cellular_component: plasma membrane, microtubule organizing center.
biological_process: oxidation-reduction process, cell division, root epidermal cell differentiation, cell tip growth, mitosis.
This polypeptide in other databases
In PhylomeDB is Phy003AD56_CUCME .

