Polypeptide MELO3C020899P2

Accession: MELO3C020899P2

Name: MELO3C020899P2

Description: Similar to Probable calcium-binding protein CML20 (Arabidopsis thaliana) (uniprot_sprot:sp|O82659|CML20_ARATH)

Sequence:

>MELO3C020899P2 Similar to Probable calcium-binding protein CML20 (Arabidopsis thaliana) (uniprot_sprot:sp|O82659|CML20_ARATH)
MASLYRGVSRKEKPKGRHGLTPQKKQEIKEAFELFDTDGSGTIDAKELNVAMRALGFEMTEEQIRQMIADVDKDGSGAID
YDEFEYMMTAKIGERDTKEELTKAFDIIDYDKNGKISGNDIKRIAKELGEVFTDKDIQEMIDEADRDRDGEVNVDDFFRM
MRRTTYGS*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Recruitment of additional gamma tubulin/ gamma TuRC to the centrosome (REACT_15467), Loss of C-Nap-1 from centrosomes (REACT_15313), Recruitment of CDK11p58 to the centrosomes (REACT_15401), Dissociation of Phospho-Nlp from the centrosome (REACT_15440), Recruitment of Plk1 to centrosomes (REACT_15470), Plk1-mediated phosphorylation of Nlp (REACT_15386).

biological_process: G2/M transition of mitotic cell cycle, mitotic cell cycle.

REACTOME_COMPLEX: Mature centrosomes enriched in gamma-TURC complexes [cytosol] (REACT_15605), centrosome containing phosphorylated Nlp [cytosol] (REACT_17093), cNAP-1 depleted centrosome [cytosol] (REACT_17186), Centrosomes containing recruited CDK11p58 [cytosol] (REACT_17657), Centrosome associated Plk1 [cytosol] (REACT_18209), Nlp-depleted centrosome [cytosol] (REACT_18075), centrosome [cytosol] (REACT_15979).

REACTOME_PATHWAY: Loss of Nlp from mitotic centrosomes (REACT_15364), Cell Cycle, Mitotic (REACT_152), Mitotic G2-G2/M phases (REACT_21391), Recruitment of mitotic centrosome proteins and complexes (REACT_15296), Loss of proteins required for interphase microtubule organization from the centrosome (REACT_15451), G2/M Transition (REACT_2203), Centrosome maturation (REACT_15479).

These properties come from phylome analysis


molecular_function: identical protein binding, protein binding, structural constituent of cytoskeleton, 2-alkenal reductase activity, ATP-dependent helicase activity, ATP binding, calcium ion binding, nucleic acid binding.

cellular_component: transcription export complex 2, half bridge of spindle pole body, nuclear pore, plasma membrane.

biological_process: transmembrane transport, mRNA transport, proteasomal ubiquitin-dependent protein catabolic process, protein transport, spindle pole body duplication in nuclear envelope, microtubule nucleation, oxidation-reduction process, cell division, mitosis.

These properties come from blast2go analysis


molecular_function: 2-alkenal reductase activity, ATP-dependent helicase activity, ATP binding, calcium ion binding, nucleic acid binding.

cellular_component: plasma membrane, microtubule organizing center.

biological_process: oxidation-reduction process, cell division, root epidermal cell differentiation, cell tip growth, mitosis.

Locations

Located in CM3.5_scaffold00045 from 2234242 to 2238751.

This polypeptide in other databases

In PhylomeDB is Phy003AD56_CUCME .

Related features