Polypeptide MELO3C021095P1
Accession: MELO3C021095P1
Name: MELO3C021095P1
Description: Similar to Transcription initiation factor TFIID subunit 1-A (Arabidopsis thaliana) (uniprot_sprot:sp|Q8LRK9|TAF1A_ARATH)
Sequence:
>MELO3C021095P1 Similar to Transcription initiation factor TFIID subunit 1-A (Arabidopsis thaliana) (uniprot_sprot:sp|Q8LRK9|TAF1A_ARATH) MQAGLYRLKHLGLSEVHPSAISSAMSRLPDEAITLAAASHIERELQITPWNLSSNFVACTTQGKENIERLEITGVGDPSG RGLGFSYVRSVPKAPISNASLKKKAASSRGSSAVTGTDADLRRLSMDAAKEVLLKFDVSEEQIAKLTRWHRIAMIRRLSS EQAASGVQVDPTTISKYARGQRMSFLQLQRQTREKCQEIWERQIQSLSASDGAENESDSEGNSDLDSFAGDLENLLDAEE FEDEVDTFEIRHEKTDGVKGLKMRRRPSIAQTEEEIEDEVAEAAEFCRLLMDDETERRRKKKKNKVMGEAVLSTGFQASF FHEKPEQTRHLISIAQPDVTYISKENIREQKEVESIINRKEKSGKLKPTKKNYSSEMSLINKKLKISGDKVKNFKEKKSA RESFVCGKCGQFGHMRTNKNCPKYGEDLETPETTDQEKVSIKLNAMDPSNQSHQKAVVKKVTPKAIAKSFTTEAFEGEKS TAKVLPVKFKCSSADRLSDNLSPALPQTSDLPVNSDNETGKSIVKVNKITFSKKRTEDIQFESHKPSIVIRPPDAKKVSL EAHKPSIVIRPPTNIDRDRTEFPRRSATIIRSAVETEKEQLHKKLIIKRPKEVIDLDRSAYDGSVDMEYRKTKRIVELSS FEKHTRYGSMSSSDSGKKKVKEKHRWWEKQEKQRNEERLREEKVRRVYNEQMGMREEQEKLAEIRRFEASIRSDKEEEER LKAKKKKKKRIPEILDDYVEDPRSRRFDKRALEKERSMKRKPIELGRHIPEHASTKRRRGGEVGLSNILERIVETLKDRF DISYLFLKPVSKKEAPDYLDIIERPMDLSTIREKVRRLEYKTRDEFRNDVWQIMYNAHLYNDGRNPGIPPLADQLLMLCD NLLKQCDEDLTEAEIGIEYRDN*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: nucleic acid binding.
These properties come from reactome analysis
REACTOME_REACTION: NTP binds active site of RNA Polymerase II in HIV-1 open pre-initiation complex (REACT_6349), Formation of the closed pre-initiation complex (REACT_632), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_1467), Abortive Initiation Before Second Transition (REACT_543), Nucleophillic attack by 3-hydroxyl oxygen of nascent HIV-1 transcript on the Alpha phosphate of NTP (REACT_6285), Fall Back to Closed Pre-initiation Complex (REACT_6211), Recognition and Binding of Core Promoter Elements by TFIID (REACT_745), Binding of TFIIE to the growing preinitiation complex (REACT_1821), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_581), Addition of nucleotides 5 through 9 on the growing HIV-1 transcript (REACT_6172), Fall Back to Closed Pre-initiation Complex (REACT_1702), Abortive initiation after formation of the first phosphodiester bond (REACT_653), NTP Binds Active Site of RNA Polymerase II (REACT_1160), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_1055), RNA Polymerase II Promoter Opening: First Transition (REACT_1844), Newly formed phosphodiester bond stabilized and PPi released (REACT_6333), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_1684), Abortive HIV-1 initiation after formation of the first phosphodiester bond (REACT_6226), HIV-1 Promoter Opening: First Transition (REACT_6134), Binding of TFIIA and TFIIB to the pol II promoter:TFIID complex (REACT_266), Abortive HIV-1 Initiation Before Second Transition (REACT_6203).
biological_process: transcription elongation from RNA polymerase II promoter, transcription from RNA polymerase II promoter, transcription initiation from RNA polymerase II promoter, viral reproduction, gene expression, viral transcription.
REACTOME_COMPLEX: pol II transcription complex containing 3 Nucleotide long transcript [nucleoplasm] (REACT_3251), pol II open pre-initiation complex [nucleoplasm] (REACT_4930), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex [nucleoplasm] (REACT_2469), HIV-1 transcription complex [nucleoplasm] (REACT_6433), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF:TFIIE complex [nucleoplasm] (REACT_4404), Pol II initiation complex [nucleoplasm] (REACT_5487), Pol II Initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_2410), TFIID [nucleoplasm] (REACT_5886), HIV-1 promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex* [nucleoplasm] (REACT_6371), HIV-1 Promoter Escape Complex [nucleoplasm] (REACT_6417), HIV-1 transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_6640), pol II closed pre-initiation complex [nucleoplasm] (REACT_5734), pol II promoter:TFIID complex [nucleoplasm] (REACT_5906), pol II promoter:TFIID:TFIIA:TFIIB complex [nucleoplasm] (REACT_2339), HIV-1 open pre-initiation complex [nucleoplasm] (REACT_6605), HIV-1 closed pre-initiation complex [nucleoplasm] (REACT_6553), pol II transcription complex [nucleoplasm] (REACT_2954), HIV-1 promoter:TFIID complex [nucleoplasm] (REACT_6369), Pol II Promoter Escape Complex [nucleoplasm] (REACT_3851), pol II transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_4148), HIV-1 initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_6680), HIV-1 promoter:TFIID:TFIIA:TFIIB complex [nucleoplasm] (REACT_6531), HIV-1 initiation complex [nucleoplasm] (REACT_6518), HIV-1 transcription complex containing 3 nucleotide long transcript [nucleoplasm] (REACT_6450).
REACTOME_PATHWAY: HIV Infection (REACT_6185), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_1655), Transcription (REACT_1788), HIV-1 Transcription Initiation (REACT_6332), Transcription of the HIV genome (REACT_6233), Formation and Maturation of mRNA Transcript (REACT_2039), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_834), RNA Polymerase II Pre-transcription Events (REACT_22107), Gene Expression (REACT_71), RNA Polymerase II Transcription (REACT_1366), RNA Polymerase II HIV-1 Promoter Escape (REACT_6253), RNA Polymerase II Promoter Escape (REACT_2089), HIV Life Cycle (REACT_6256), Late Phase of HIV Life Cycle (REACT_6361), RNA Polymerase II Transcription Initiation (REACT_1851).
These properties come from phylome analysis
molecular_function: transferase activity, zinc ion binding, translation initiation factor activity, nucleic acid binding.
These properties come from kegg analysis
KEGG_ORTHOLOGS: transcription initiation factor TFIID subunit 1 (K03125).
molecular_function: general RNA polymerase II transcription factor activity.
This polypeptide in other databases
In PhylomeDB is Phy003MFP1_CUCME .
