Polypeptide MELO3C021258P1
Accession: MELO3C021258P1
Name: MELO3C021258P1
Description: Similar to Flowering time control protein FCA (Arabidopsis thaliana) (uniprot_sprot:sp|O04425|FCA_ARATH)
Sequence:
>MELO3C021258P1 Similar to Flowering time control protein FCA (Arabidopsis thaliana) (uniprot_sprot:sp|O04425|FCA_ARATH) MGTAGGFRPIPGPGGGGFGSGFQAPPVVGQKRGYPFAGRGSSPDHSDGSNFAKLFVGSVPRTATEEIIRPLFEEHGNVIE VALIKDKRTGQQQGCCFVKYTTSEEADRAIRNLHNQHTLPGGVGPIQVRYADGERERLGAVEYKLFVGSLNKQASEKEVK EIFSPYGVVEDVYLMRDEMKQSRGCGFVKYSHRDMALAAINALNGIFTMRGCDQPLSVRFADPKKPRPGDSRGTPAFGGP GFGSRFQPPGPRPTPNFGEFMGDRIPIDVRGFRPPVDAGIHPFGGQLPPRSSEMGLPLNLGGPAGGFRGPNQGLANPAPS ASQQNFNQSASQHPPPGLQVSPVLKTSQSPKQLPPSNQLHSHAPAYSQTHTSPALAQQHNQPQNFNSSGQLPFSQPAPSQ ESPGLGGQLAVSQSMGASSAAATHAPLSMNLQSHAAAPSQQQLPTPIQPPQNSPSQLAHMLSQQKQTLQARFQSSQQAFS QLQQQLQQIQPPNQSSTLQPSSQPIKQQPHWAGVGPHTAASATSATSDAHTSTVPPAARNTQVVAPVKCNWTEHTSPDGY KYYYNSVTGESKWERPEELSVIEQQQQKPPILQPHNQPHPQLLSTQQLSQTPQPQLQTQFQTQSPMPHPQPLLQPSFHSQ EGAYTQMQPTNNSVNDPTRFHQGFPATQEWAWKNK*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Formation of UPF1:eRF3 Complex on mRNA with a Premature Termination Codon and No Exon Junction Complex (REACT_75917), Formation of translation initiation complexes yielding circularized Ceruloplasmin mRNA in a closed-loop conformation (REACT_1515), SMG1 Phosphorylates UPF1 (Enhanced by Exon Junction Complex) (REACT_75910), Deadenylation of mRNA by PARN (REACT_20662), UPF1 Binds an mRNP with a Termination Codon Preceding an Exon Junction Complex (REACT_75753), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_1595), Association of AUF1 with Translation and Heat Shock Proteins (REACT_25267), Deadenylation of mRNA by the CCR4-NOT Complex (REACT_20651), Partial Deadenylation of mRNA by the PAN2-PAN3 Complex (REACT_20606).
REACTOME_PATHWAY: Translation initiation complex formation (REACT_1979), Regulation of mRNA Stability by Proteins that Bind AU-rich Elements (REACT_24994), Nonsense Mediated Decay Independent of the Exon Junction Complex (REACT_75768), Nonsense-Mediated Decay (REACT_75886), Translation (REACT_1014), Nonsense Mediated Decay Enhanced by the Exon Junction Complex (REACT_75822), 3 -UTR-mediated translational regulation (REACT_1762), Cap-dependent Translation Initiation (REACT_2099), Gene Expression (REACT_71), Deadenylation of mRNA (REACT_20514), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_79), Destabilization of mRNA by AUF1 (hnRNP D0) (REACT_25325), Eukaryotic Translation Initiation (REACT_2159), Metabolism of mRNA (REACT_20605), Metabolism of RNA (REACT_21257), Metabolism of proteins (REACT_17015), Deadenylation-dependent mRNA decay (REACT_20639), Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S (REACT_1258).
REACTOME_COMPLEX: SMG1:Phosphorylated UPF1:EJC:Translated mRNP [cytosol] (REACT_76156), AUF1 Complexed with Translation and Heat Shock Proteins [cytosol] (REACT_25605), Partially Deadenylated mRNA Complex [cytosol] (REACT_20682), mRNA Complex with a Premature Termination Codon Preceding an Exon Junction [cytosol] (REACT_76207), 43S: Ceruloplasmin mRNA:eIF4F:eIF4B:eIF4H:PABP [cytosol] (REACT_3267), UPF1:eRF3 Complex on Translated mRNA [cytosol] (REACT_76212), Translated mRNA Complex with Premature Termination Codon Not Preceding Exon Junction [cytosol] (REACT_76767), SMG1:UPF1:EJC:Translated mRNP [cytosol] (REACT_76647), Translated mRNA Complex with Premature Termination Codon Preceding Exon Junction [cytosol] (REACT_76510), mRNA Cleaved by SMG6 [cytosol] (REACT_76273), Translatable mRNA Complex [cytosol] (REACT_21129), mRNA Complex with a Premature Termination Codon Not Preceding an Exon Junction [cytosol] (REACT_76342), Phosphorylated UPF1:SMG5:SMG7:SMG6:PP2A:Translated mRNP [cytosol] (REACT_76275), phospho-L13a associated wth the 3 UTR GAIT element of ceruloplasmin mRNA within the translation initiation complex [cytosol] (REACT_5151).
biological_process: translation, mRNA metabolic process, RNA metabolic process, gene expression, nuclear-transcribed mRNA poly(A) tail shortening, nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay, cellular protein metabolic process.
These properties come from phylome analysis
molecular_function: protein binding, RNA binding, nucleotide binding.
cellular_component: nucleus, chromatin.
biological_process: chromatin silencing by small RNA, cell differentiation, regulation of flower development, flower development, embryo development, embryo sac development.
These properties come from blast2go analysis
molecular_function: nucleic acid binding.
This polypeptide in other databases
In PhylomeDB is Phy003A73V_CUCME .
