Polypeptide MELO3C021347P3
Accession: MELO3C021347P3
Name: MELO3C021347P3
Description: Similar to 5'-AMP-activated protein kinase subunit gamma (Dictyostelium discoideum) (uniprot_sprot:sp|Q8T277|PRKAG_DICDI)
Sequence:
>MELO3C021347P3 Similar to 5'-AMP-activated protein kinase subunit gamma (Dictyostelium discoideum) (uniprot_sprot:sp|Q8T277|PRKAG_DICDI) MFASSMDTVRDTARTAGTLLIPMRFVWPYGGRSVFLSGSFTRWSELVPMTPMEGCPTVFQAIYSLTPGYHQYKFFVDGEW RHDEQQTCVSGEYGVVNTVLLATEPSYAAPLASPEMTPGSSMDVDNEAFRRLVRINDGRLSEAVHSISEADLQCSRHRIS AFLSTHTVYELLPESGKVVALDIDLPVKQAFHILHEQGIPTAPLWDFSKGQFVGVLSASDFILILKELGKRGSNLTEEEL ETHTISAWKEGKAYLNGRVDGQGRFLSRQFIHAEPFDNLKDVALKILQNQVATVPIIHSSAEDGSFPQLLHLASLSGILK CICRYFRHCSSLLPVLQLPIFAIPVGTWVPKIGESNGRPLAMLRPSASLSSALNLLIQAQVSSIPIVDDNDSLLDVYCRS DITALAKDRAYTHINLDEMTIHQALQLGQDSFSLYEPRSQRCQMCLRSDSLHKVMDRLANPGVRRLVIVEAGSKRVEGII SLSDIFKFLLG*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_627), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_11110), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_105858), Activation of cytosolic AMPK by phosphorylation (REACT_31513), Phosphorylation of ChREBP at Serine 568 by AMPK (REACT_349), AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_88296), LKB1 phosphorylates the alpha subunit of AMPK heterotrimer (REACT_85508), LKB1 phosphorylates the alpha subunit of AMPK heterotrimer (REACT_96873), Phosphorylated AMPK binds AMP (REACT_107153), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_28253), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_32411), Phosphorylated AMPK phosphorylates TSC2 (REACT_21348), LKB1 phosphorylates the alpha subunit of AMPK heterotrimer (REACT_1325), Phosphorylation of ChREBP at Serine 568 by AMPK (REACT_101245), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_79108), Phosphorylated AMPK binds AMP (REACT_31999), AMPK is dephosphorylated (REACT_109701), AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_78314), Phosphorylated AMPK binds AMP (REACT_21293), AMPK is dephosphorylated (REACT_21418), AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_34086), AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_90770), AMPK phosphorylates Raptor (REACT_21413), Activation of cytosolic AMPK by phosphorylation (REACT_11183), Phosphorylated AMPK binds AMP (REACT_81047), Phosphorylated AMPK binds AMP (REACT_108380), AMPK is dephosphorylated (REACT_79893), Activation of cytosolic AMPK by phosphorylation (REACT_98315), LKB1 phosphorylates the alpha subunit of AMPK heterotrimer (REACT_29816), Phosphorylated AMPK phosphorylates TSC2 (REACT_97911).
biological_process: regulation of fatty acid biosynthetic process, cellular lipid metabolic process, cell cycle arrest, carnitine shuttle, insulin receptor signaling pathway, energy reserve metabolic process, regulation of fatty acid oxidation.
REACTOME_COMPLEX: Phosphorylated AMPK heterotrimer [cytosol] (REACT_17720), AMPK heterotrimer:AMP [nucleoplasm] (REACT_4802), AMPK heterotrimer (inactive) [nucleoplasm] (REACT_3733), AMPK heterotrimer [cytosol] (REACT_18135), Phosphorylated AMPK heterotrimer:AMP [cytosol] (REACT_21851), AMPK heterotrimer (active) [cytosol] (REACT_11854), Activated AMPK heterotrimer [nucleoplasm] (REACT_5306), AMPK gamma2:AMP [nucleoplasm] (REACT_4963).
REACTOME_PATHWAY: Energy dependent regulation of mTOR by LKB1-AMPK (REACT_21387), PI3K Cascade (REACT_976), PI3K Cascade (REACT_29438), Integration of energy metabolism (REACT_87289), PKB-mediated events (REACT_93663), Integration of energy metabolism (REACT_93425), IRS-related events (REACT_29919), Integration of energy metabolism (REACT_31409), Insulin receptor signalling cascade (REACT_30635), Regulation of AMPK activity via LKB1 (REACT_21285), IRS-mediated signalling (REACT_82708), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_92909), Signaling by Insulin receptor (REACT_6313), IRS-related events (REACT_762), Regulation of AMPK activity via LKB1 (REACT_106029), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_30569), AMPK inhibits chREBP transcriptional activation activity (REACT_109849), Signaling by Insulin receptor (REACT_28335), IRS-mediated signalling (REACT_97132), PI3K Cascade (REACT_81331), IRS-mediated signalling (REACT_87267), Insulin receptor signalling cascade (REACT_90766), mTOR signalling (REACT_6838), AMPK inhibits chREBP transcriptional activation activity (REACT_86711), IRS-mediated signalling (REACT_81492), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_84630), Regulation of Rheb GTPase activity by AMPK (REACT_107474), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_98981), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_31891), Signaling by Insulin receptor (REACT_498), IRS-related events (REACT_104222), Metabolism of lipids and lipoproteins (REACT_81798), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_101666), Metabolism of lipids and lipoproteins (REACT_104203), Regulation of AMPK activity via LKB1 (REACT_33744), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_94410), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_83004), PKB-mediated events (REACT_103699), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_87938), Regulation of Rheb GTPase activity by AMPK (REACT_21393), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_78416), Metabolism of lipids and lipoproteins (REACT_22258), Signaling by Insulin receptor (REACT_101830), AMPK inhibits chREBP transcriptional activation activity (REACT_1988), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_95569), mTOR signalling (REACT_101313), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_22279), PI3K Cascade (REACT_80065), Insulin receptor signalling cascade (REACT_91258), IRS-related events (REACT_87578), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_11082), Metabolism of lipids and lipoproteins (REACT_109614), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_90301), mTOR signalling (REACT_32181), Regulation of AMPK activity via LKB1 (REACT_108246), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_92175), IRS-related events (REACT_97171), mTOR signalling (REACT_109003), PKB-mediated events (REACT_456), AMPK inhibits chREBP transcriptional activation activity (REACT_104762), Integration of energy metabolism (REACT_1505), PI3K Cascade (REACT_101713), mTOR signalling (REACT_103104), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_99720), Signaling by Insulin receptor (REACT_78672), PKB-mediated events (REACT_87931), IRS-mediated signalling (REACT_332), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_87905), Regulation of AMPK activity via LKB1 (REACT_86986), Insulin receptor signalling cascade (REACT_31597), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_11163), Integration of energy metabolism (REACT_89538), Metabolism of lipids and lipoproteins (REACT_106721), Insulin receptor signalling cascade (REACT_1195), PKB-mediated events (REACT_87031), AMPK inhibits chREBP transcriptional activation activity (REACT_102284), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_102111).
These properties come from phylome analysis
molecular_function: catalytic activity, kinase activity.
biological_process: positive regulation of cell cycle, cholesterol homeostasis.
These properties come from blast2go analysis
molecular_function: kinase activity, protein binding.
This polypeptide in other databases
In PhylomeDB is Phy003A7X0_CUCME .