Polypeptide MELO3C021389P2

Accession: MELO3C021389P2

Name: MELO3C021389P2

Description: Similar to Calcium-binding protein 39 (Mus musculus) (uniprot_sprot:sp|Q06138|CAB39_MOUSE)

Sequence:

>MELO3C021389P2 Similar to Calcium-binding protein 39 (Mus musculus) (uniprot_sprot:sp|Q06138|CAB39_MOUSE)
MSFSFFKPSRPKTPQEVAKVIKDSLMALDTKTVVEVRALEKAMEEVEKNFVTMRCMLTGDAEVEPNADQVLQLTQEICKE
CVIDLLIHKLPVLGWEARKDLVNCWSILLKQKVASTYCCVQYIENHFELLDFLVVCYDNKEIAVNCGNMLRECIKFPTLA
KYILESASFELFFKFVELPNFDVASDAFSTFKDLLTKHADIVSDFLSSHYDEFFDRYEALLTSSNYVTRRQSLKLLSEFL
LESPNSQIMKRYILEVRNLKVMMTLLKDSSKNIQLSAFHIFKVFVANPNKPREIKLILSKNHEKLLELLHNLSPGKGAED
EQFEEEKELIIKEIERVTLMQRLDR*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: LKB1 forms a trimeric complex with STRAD and MO25 (REACT_83248), LKB1 forms a trimeric complex with STRAD and MO25 (REACT_21345), LKB1 forms a trimeric complex with STRAD and MO25 (REACT_78349), Activation of cytosolic AMPK by phosphorylation (REACT_98315), Activation of cytosolic AMPK by phosphorylation (REACT_31513), Activation of cytosolic AMPK by phosphorylation (REACT_11183).

biological_process: cell cycle arrest, insulin receptor signaling pathway, regulation of fatty acid oxidation.

REACTOME_COMPLEX: LKB1:STRAD:MO25 [cytosol] (REACT_17994).

REACTOME_PATHWAY: Energy dependent regulation of mTOR by LKB1-AMPK (REACT_21387), PI3K Cascade (REACT_976), Insulin receptor signalling cascade (REACT_30635), Regulation of AMPK activity via LKB1 (REACT_21285), Signaling by Insulin receptor (REACT_6313), IRS-related events (REACT_762), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_30569), PI3K Cascade (REACT_81331), IRS-mediated signalling (REACT_332), Insulin receptor signalling cascade (REACT_90766), mTOR signalling (REACT_6838), mTOR signalling (REACT_32181), IRS-mediated signalling (REACT_81492), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_84630), IRS-related events (REACT_104222), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_78416), Signaling by Insulin receptor (REACT_498), mTOR signalling (REACT_101313), PI3K Cascade (REACT_80065), PKB-mediated events (REACT_87031), Regulation of AMPK activity via LKB1 (REACT_108246), PKB-mediated events (REACT_456), Regulation of AMPK activity via LKB1 (REACT_86986), Signaling by Insulin receptor (REACT_78672), PKB-mediated events (REACT_87931), IRS-mediated signalling (REACT_97132), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_11163), Insulin receptor signalling cascade (REACT_1195), IRS-related events (REACT_87578), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_102111).

These properties come from phylome analysis


molecular_function: binding.

cellular_component: ribonucleoprotein complex.

biological_process: ribosome biogenesis.

These properties come from blast2go analysis


molecular_function: binding.

cellular_component: ribonucleoprotein complex.

biological_process: ribosome biogenesis.

Locations

Located in CM3.5_scaffold00047 from 2017286 to 2022004.

This polypeptide in other databases

In PhylomeDB is Phy003AD7H_CUCME .

Related features