Polypeptide MELO3C021410P2

Accession: MELO3C021410P2

Name: MELO3C021410P2

Description: Similar to Peroxiredoxin-2F, mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|Q9M7T0|PRX2F_ARATH)

Sequence:

>MELO3C021410P2 Similar to Peroxiredoxin-2F, mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|Q9M7T0|PRX2F_ARATH)
MASAILKRVSASAMSSLVESIRIGASSRNFAAVAVGTDIVSAAPDVSLQKARSWDEGVSSKFSTTPLKDIFKGKKVVIFG
LPGAYTGVCSQQHVPSYNNKIDEFKAKGIDSVICVSVNDPYTLNGWAEKLQAKDAIQFFGDFDGKFHKSLELDKDLSVAL
LGPRSERWSAYVVDGKVKALNVEEAPSDFKVTGADVILNQI*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: peroxiredoxin activity, peroxidase activity.

cellular_component: mitochondrion.

biological_process: oxidation-reduction process, cell redox homeostasis.

These properties come from phylome analysis


molecular_function: caspase inhibitor activity, oxidoreductase activity, thioredoxin peroxidase activity, protein binding, peroxiredoxin activity, peroxidase activity.

cellular_component: cytosolic part, cytosol, peroxisome, mitochondrial matrix, cytoplasm, nucleus, plasma membrane enriched fraction, mitochondrion.

biological_process: response to cadmium ion, negative regulation of apoptosis, cellular response to reactive oxygen species, cellular response to oxidative stress, response to metal ion, determination of adult lifespan, response to oxidative stress, inflammatory response, oxidation-reduction process, cell redox homeostasis.

Locations

Located in CM3.5_scaffold00047 from 2214154 to 2216382.

This polypeptide in other databases

In PhylomeDB is Phy003AE4N_CUCME .

Related features