Polypeptide MELO3C021442P1
Accession: MELO3C021442P1
Name: MELO3C021442P1
Description: Similar to Histone deacetylase 9 (Arabidopsis thaliana) (uniprot_sprot:sp|Q8H0W2|HDA9_ARATH)
Sequence:
>MELO3C021442P1 Similar to Histone deacetylase 9 (Arabidopsis thaliana) (uniprot_sprot:sp|Q8H0W2|HDA9_ARATH) MRSKDRISYFYDGDVGSVYFGPNHPMKPHRLCMTHHLVLSYELHKKMEIYRPHKAYPVELAQFHSADYVEFLHRINPDTQ HLFANELSKYNLGEDCPVFENLFEFCQIYAGGTIDAARRLNHQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELL KYHSRVLYIDIDVHHGDGVEEAFYFTDRVMTVSFHKYGDLFFPGTGDVKEIGEREGKFYAINVPLKDGIDDGSFTRLFRT IISKVVEMYRPGVIVLQCGADSLAGDRLGCFNLSIDGHAECVRFVKKFNLPLLVTGGGGYTKENVARCWTVETGVLLDTE LPNEIPDNEYIKYFSPDHLLRIPNGHMENLNTKSYLSTIKTQVLENLRFIQHAPGVQMQEVPPDFYIPDFDEDGQNPDER MNRHTQDKQIQRDDEYYEGDNDNDHDMDDA*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: histone deacetylase activity.
biological_process: histone deacetylation.
These properties come from reactome analysis
biological_process: nerve growth factor receptor signaling pathway, negative regulation of cell cycle, cellular lipid metabolic process.
REACTOME_REACTION: PRDM4 inhibits cyclin E transcription (REACT_13434), PPARG:RXRA Heterodimer binds to PPARG corepressors (REACT_27280), Recruitment of Corepressors by PPARA:RXRA Heterodimer (REACT_19283), PPARG:RXRA Heterodimer Binds to Fatty Acid-like Ligands (REACT_27257), Activation of PPARA by Fatty Acid Ligands (REACT_106112), Activation of PPARA by Fatty Acid Ligands (REACT_19175).
REACTOME_COMPLEX: PRDM4:Histone deacetylase [nucleoplasm] (REACT_14535), PPARG:RXRA:Corepressor Complex [nucleoplasm] (REACT_27552), PPARA:RXRA Repressor Complex [nucleoplasm] (REACT_19814).
REACTOME_PATHWAY: Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) (REACT_105645), Metabolism of lipids and lipoproteins (REACT_22258), p75 NTR receptor-mediated signalling (REACT_13776), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_22279), Diabetes pathways (REACT_15380), Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha) (REACT_19241), Transcriptional Regulation of White Adipocyte Differentiation (REACT_27161), p75NTR negatively regulates cell cycle via SC1 (REACT_13695), Metabolism of lipids and lipoproteins (REACT_106721), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_87905), Signalling by NGF (REACT_11061).
These properties come from phylome analysis
molecular_function: NAD-dependent histone deacetylase activity (H4-K16 specific), NAD-dependent histone deacetylase activity (H3-K9 specific), NAD-independent histone deacetylase activity, histone deacetylase binding, histone deacetylase activity (H3-K16 specific), NAD-dependent histone deacetylase activity (H3-K14 specific), NAD-dependent histone deacetylase activity, transcription repressor activity, transcription factor binding, protein binding, transcription corepressor activity, histone deacetylase activity.
cellular_component: Rpd3L-Expanded complex, Set3 complex, transcriptional repressor complex, spindle microtubule, cytoplasm, nucleus, histone deacetylase complex.
biological_process: spindle assembly, nerve growth factor receptor signaling pathway, negative regulation of JNK cascade, negative regulation of meiosis, negative regulation of cell cycle, tail tip morphogenesis, cellular lipid metabolic process, negative regulation of apoptosis, DNA protection, positive regulation of locomotion, locomotion, growth, positive regulation of stress-activated MAPK cascade, negative regulation of gene-specific transcription from RNA polymerase II promoter, embryo development ending in birth or egg hatching, response to DNA damage stimulus, anti-apoptosis, regulation of transcription, DNA-dependent, transcription, DNA-dependent, chromatin silencing, nematode larval development, negative regulation of transcription from RNA polymerase II promoter, reproduction, histone deacetylation.
These properties come from kegg analysis
molecular_function: histone deacetylase activity.
This polypeptide in other databases
In PhylomeDB is Phy003A7D7_CUCME .
