Polypeptide MELO3C021574P1

Accession: MELO3C021574P1

Name: MELO3C021574P1

Description: Similar to Cytochrome c oxidase subunit 1 (Pisum sativum) (uniprot_sprot:sp|P12786|COX1_PEA)

Sequence:

>MELO3C021574P1 Similar to Cytochrome c oxidase subunit 1 (Pisum sativum) (uniprot_sprot:sp|P12786|COX1_PEA)
MLFVVGSIFLFTIGELIRIVPTNSGLSIALHDTYFVVAHFHYVLSIGVVMIFCFNCRISLLGQIHFWITFFRVNPTLFPM
HFLGLLGMPRRIPDYLDAYADDG*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: oxidoreductase activity, iron ion binding.

cellular_component: membrane part, mitochondrion.

biological_process: oxidation-reduction process, generation of precursor metabolites and energy.

These properties come from phylome analysis


molecular_function: heme binding, electron carrier activity, cytochrome-c oxidase activity, oxidoreductase activity.

cellular_component: respiratory chain, integral to membrane, mitochondrial inner membrane.

biological_process: electron transport chain, aerobic respiration, transport.

Locations

Located in CM3.5_scaffold00048 from 1463892 to 1464242.

This polypeptide in other databases

In PhylomeDB is Phy003MFAH_CUCME .

Related features