Polypeptide MELO3C021620P2

Accession: MELO3C021620P2

Name: MELO3C021620P2

Description: Similar to Putative uncharacterized protein (Glycine max) (uniref90:UniRef90_C6T015)

Sequence:

>MELO3C021620P2 Similar to Putative uncharacterized protein (Glycine max) (uniref90:UniRef90_C6T015)
MEEQFVLRVPPSVAERIERLLNENASSSEDASLDLSFSEDGRSGTFAIGDDHFPASLLDLPCVVESYKTYDDTVLIKAAD
IGQMIMVREPGDPAPDSTEYRHGLTPPMRDARKRRFRREPDLNPELVRRVEKDLLNIMAGGTTENADVGVAEQQDDRDEN
PHHTNAKPASAPAPKPDVMETETNVGEPERSDSDDSDHSID*

Download fasta sequence.

Properties

These properties come from kegg analysis


molecular_function: general RNA polymerase II transcription factor activity.

These properties come from phylome analysis


molecular_function: protein binding, sequence-specific DNA binding transcription factor activity, general RNA polymerase II transcription factor activity.

cellular_component: transcription factor TFIID complex.

biological_process: regulation of transcription, DNA-dependent, transcription initiation from RNA polymerase II promoter.

These properties come from blast2go analysis


molecular_function: general RNA polymerase II transcription factor activity.

cellular_component: transcription factor TFIID complex.

biological_process: transcription initiation from RNA polymerase II promoter.

Locations

Located in CM3.5_scaffold00048 from 2018687 to 2020966.

This polypeptide in other databases

In PhylomeDB is Phy003LHIC_CUCME .

Related features