Polypeptide MELO3C021633P1
Accession: MELO3C021633P1
Name: MELO3C021633P1
Description: Similar to Actin-1 (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q10DV7|ACT1_ORYSJ)
Sequence:
>MELO3C021633P1 Similar to Actin-1 (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q10DV7|ACT1_ORYSJ) MADAEDIQPLVCDNGTGMVKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSN WDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDG VSHTVPIYEGYALPHAILRLDLAGRDLTDNLMKILTERGYSFTTTAEREIVRDMKEKLSYIALDYEQELETSKTSSSVEK SYELPDGQVITIGAERFRCPEVLFQPSMIGMEAAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFSGIADRMSKEIS ALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDESGPSIVHRKCF*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Hydrolysis of ATP and release of folded actin from CCT/TriC (REACT_16915), Ankyrins link voltage-gated sodium and potassium channels to spectrin and L1 (REACT_22364), Dab2 is recruited to the junctional plaques (REACT_9951), Calcium Binds Troponin-C (REACT_16935), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_82740), ATP Hydrolysis By Myosin (REACT_16995), Internalization of gap junction plaques (REACT_9971), unfolded actin/tubulin associates with prefoldin (REACT_82152), F-actin capping protein binds to the barbed end of elongating F-actin (REACT_25135), Myosin Binds ATP (REACT_20663), Myosin Binds ATP (REACT_95095), Calcium Binds Caldesmon (REACT_20643), MigFilin associates with Filamin and F-actin (REACT_20513), Linkage of L1 with treadmilling F-actin (REACT_22244), Release Of ADP From Myosin (REACT_79344), Interaction of Afadin with F-actin (REACT_19163), Hydrolysis of ATP and release of folded actin from CCT/TriC (REACT_78266), Dephosphorylation of pL1 (Y1176) (REACT_22109), Shootin-1 links L1 and retrograde actin flow (REACT_22168), Dynamin is recruited to the gap junction plaque (REACT_9969), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_16961), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_111017), ATP Hydrolysis By Myosin (REACT_20548), unfolded actin/tubulin associates with prefoldin (REACT_16892), ATP Hydrolysis By Myosin (REACT_99052), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_17011), Release Of ADP From Myosin (REACT_17057), L1 linked to actin cytoskeleton by ankyrin (REACT_22148), Calcium Binds Caldesmon (REACT_95190), Myosin Binds ATP (REACT_16902), Release Of ADP From Myosin (REACT_20613).
biological_process: muscle filament sliding, cell junction assembly, cell-cell junction organization, muscle contraction, chaperone mediated protein folding independent of cofactor, cellular membrane organization, 'de novo' posttranslational protein folding, cellular protein metabolic process, axon guidance, blood coagulation, adherens junction organization, protein folding.
REACTOME_COMPLEX: CCT/TriC(ATP)-associated actin [cytosol] (REACT_17160), Invaginating gap junction plaques [peroxisomal membrane] (REACT_10333), CCT/TriC (ADP) associated actin [cytosol] (REACT_17090), ATP:Calcium Bound Sarcomere Protein Complex [cytosol] (REACT_18068), Planar gap junction plaques associated with Dab2 and Dynamin [plasma membrane] (REACT_10413), planar gap junction plaques associated with Dab2 [plasma membrane] (REACT_10755), Neurofascin:NrCAM:Ankyrin:spectrin based actin:Na+/K+ channel [plasma membrane] (REACT_22749), Thin Filament [cytosol] (REACT_17696), actin/tubulin-bound CCT/TriC(ADP) [cytosol] (REACT_17195), ATP:Calcium Bound Myosin Actin Complex [cytosol, extracellular region, plasma membrane] (REACT_20759), spectrin based actin [cytosol] (REACT_22921), Migfilin:Filamin A:F-actin [cytosol] (REACT_20733), actin:ATP [cytosol] (REACT_19528), Neurofascin:NrCAM:Ankyrin:spectrin based actin [plasma membrane] (REACT_23030), Calcium Bound Myosin Actin Complex [cytosol, extracellular region, plasma membrane] (REACT_21082), Inactive Myosin Actin Contractile Complex [cytosol, extracellular region, plasma membrane] (REACT_20794), Inactive Sarcomere Protein Complex [cytosol] (REACT_17721), pL1:ERM:F-actin [plasma membrane] (REACT_22519), ADP:Calcium Bound Sarcomere Protein Complex [cytosol] (REACT_17580), planar gap junction plaques containing Dab2 [peroxisomal membrane] (REACT_10520), pL1:Shootin-1:F-actin [plasma membrane] (REACT_22531), junctional plaque prior to invagination [peroxisomal membrane] (REACT_10909), F-actin capping protein:f-actin [cytosol] (REACT_26552), Prefoldin-associated actin/tubulin [cytosol] (REACT_18141), Afadin:F-actin [cytosol] (REACT_19820), planar gap junction plaques [plasma membrane] (REACT_10866), Calcium Bound Sarcomere Protein Complex [cytosol] (REACT_17110), ADP:Calcium Bound Myosin Actin Complex [cytosol, extracellular region, plasma membrane] (REACT_20931), actin:ATP [cytosol] (REACT_25572), L1 dimer:Ankyrin:Spectrin:F-actin [plasma membrane] (REACT_22451), Thin Filament With Troponin Bound Calcium [cytosol] (REACT_17139).
REACTOME_PATHWAY: Interaction between L1 and Ankyrins (REACT_22266), Recycling pathway of L1 (REACT_22365), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_16936), Hemostasis (REACT_604), Protein folding (REACT_16952), Folding of actin by CCT/TriC (REACT_91038), Gap junction degradation (REACT_11035), Smooth Muscle Contraction (REACT_97034), Smooth Muscle Contraction (REACT_20558), Factors involved in megakaryocyte development and platelet production (REACT_24970), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_93325), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_17029), Chaperonin-mediated protein folding (REACT_17004), Gap junction trafficking (REACT_9411), Muscle contraction (REACT_17044), L1CAM interactions (REACT_22205), Cell-extracellular matrix interactions (REACT_20649), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_91371), Cell-cell junction organization (REACT_19331), Membrane Trafficking (REACT_11123), Folding of actin by CCT/TriC (REACT_17050), Gap junction trafficking and regulation (REACT_9480), Metabolism of proteins (REACT_85873), Striated Muscle Contraction (REACT_16969), Cell junction organization (REACT_20676), Metabolism of proteins (REACT_17015), Adherens junctions interactions (REACT_19195), Chaperonin-mediated protein folding (REACT_32155), Formation of annular gap junctions (REACT_11049), Muscle contraction (REACT_99378), Axon guidance (REACT_18266), Protein folding (REACT_30135).
These properties come from blast2go analysis
molecular_function: ATP binding, protein binding.
cellular_component: cytoskeleton, cytoplasm.
This polypeptide in other databases
In PhylomeDB is Phy003LI9Y_CUCME .

