Polypeptide MELO3C021654P1

Accession: MELO3C021654P1

Name: MELO3C021654P1

Description: Similar to Geranylgeranyl transferase type-1 subunit beta (Rattus norvegicus) (uniprot_sprot:sp|P53610|PGTB1_RAT)

Sequence:

>MELO3C021654P1 Similar to Geranylgeranyl transferase type-1 subunit beta (Rattus norvegicus) (uniprot_sprot:sp|P53610|PGTB1_RAT)
MDSDSSLLEDSSTPSPSPSPSPSSSSGFDRDRHVRFLEMMYQLLPFQYQTQEINHLTLAYFVISGLELLGAMDRVDKDKI
ANWVLSFQALPTIKAENPTGEFYGFCGSRSSQFPPGENGDLIHNGSHLASTYCALAILKVIGYDFSNIDSESIAISMRNL
QQSDGSFVPIHIGAEADLRFIYCAAAICYMLENWSGMDKQKTKTYILNCQSYDGGFGLTPGSESHGGGTYCAIASLRLMG
FIEDDLLSRDNPSSIINVPLLLEWCLQKQAADGGFQGRPNKPADTCYAFWIGSTLRILGGLDFIDKKALKAFLLTCQSKY
GGFSKFPMDFPDLYHSYYGFTAFSLLEEPDINSLFVELGITDVSAWRI*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: geranylgeranyl transferase type-1 subunit beta [EC:2.5.1.59] (K11713).

molecular_function: CAAX-protein geranylgeranyltransferase activity.

These properties come from phylome analysis


molecular_function: protein heterodimerization activity, metal ion binding, catalytic activity, protein binding, Rab geranylgeranyltransferase activity, CAAX-protein geranylgeranyltransferase activity.

cellular_component: CAAX-protein geranylgeranyltransferase complex.

biological_process: embryonic heart tube development, establishment of cell polarity, protein geranylgeranylation, negative regulation of abscisic acid mediated signaling pathway, response to abscisic acid stimulus, response to auxin stimulus, response to water deprivation, small GTPase mediated signal transduction, cellular calcium ion homeostasis.

These properties come from blast2go analysis


molecular_function: peptide binding, isoprenoid binding, zinc ion binding, drug binding, protein binding, Rab geranylgeranyltransferase activity, CAAX-protein geranylgeranyltransferase activity.

cellular_component: CAAX-protein geranylgeranyltransferase complex.

biological_process: response to protein stimulus, negative regulation of nitric-oxide synthase 2 biosynthetic process, positive regulation of cell cycle, response to cytokine stimulus, positive regulation of cell proliferation.

Locations

Located in CM3.5_scaffold00048 from 2510561 to 2514045.

This polypeptide in other databases

In PhylomeDB is Phy003A65O_CUCME .

Related features