Polypeptide MELO3C021746P1

Accession: MELO3C021746P1

Name: MELO3C021746P1

Description: Similar to Proteasome subunit alpha type-5 (Glycine max) (uniprot_sprot:sp|Q9M4T8|PSA5_SOYBN)

Sequence:

>MELO3C021746P1 Similar to Proteasome subunit alpha type-5 (Glycine max) (uniprot_sprot:sp|Q9M4T8|PSA5_SOYBN)
MFLTRTEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGLKTKEGVVLAVEKRITSPLLEPSSVEKIMEIDEHIGCAMSG
LIADAHTLVEHARVETQNHRFSYGEPMTVESTTQALCDLALRFGEGDEESMSRPFGVALLIAGHDEKGPSLFYTDPSGTF
WQCNAKAIGSGSEGADSSLQEQYNKDLTLQEAETIALSILKQVMEEKVTPSNVDIAKVSPTYHLYTPAEVEAVISRL*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: threonine-type endopeptidase activity.

cellular_component: cytosolic ribosome, proteasome core complex, alpha-subunit complex, plasma membrane, nucleus.

biological_process: response to cadmium ion, ubiquitin-dependent protein catabolic process.

These properties come from reactome analysis


REACTOME_COMPLEX: 26S proteasome [nucleoplasm] (REACT_7467), 26S proteasome [cytosol] (REACT_2353).

These properties come from phylome analysis


molecular_function: protein binding, threonine-type endopeptidase activity.

cellular_component: nuclear outer membrane-endoplasmic reticulum membrane network, proteasome storage granule, mitochondrion, cytoplasm, proteasome core complex, alpha-subunit complex, nucleus.

biological_process: positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, proteasomal ubiquitin-dependent protein catabolic process, regulation of apoptosis, locomotion, growth, anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process, mRNA metabolic process, viral reproduction, proteasomal ubiquitin-independent protein catabolic process, embryo development ending in birth or egg hatching, determination of adult lifespan, DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest, apoptosis, regulation of cellular amino acid metabolic process, nematode larval development, M/G1 transition of mitotic cell cycle, S phase of mitotic cell cycle, G1/S transition of mitotic cell cycle, reproduction, ubiquitin-dependent protein catabolic process.

These properties come from kegg analysis


KEGG_ORTHOLOGS: 20S proteasome subunit alpha 5 [EC:3.4.25.1] (K02729).

COG: 20S proteasome, alpha and beta subunits (COG0638).

Locations

Located in CM3.5_scaffold00049 from 1317071 to 1320929.

This polypeptide in other databases

In PhylomeDB is Phy003A6A8_CUCME .

Related features