Polypeptide MELO3C021939P1

Accession: MELO3C021939P1

Name: MELO3C021939P1

Description: Similar to Guanine nucleotide-binding protein alpha-2 subunit (Glycine max) (uniprot_sprot:sp|P93163|GPA2_SOYBN)

Sequence:

>MELO3C021939P1 Similar to Guanine nucleotide-binding protein alpha-2 subunit (Glycine max) (uniprot_sprot:sp|P93163|GPA2_SOYBN)
MAGILKKFFHEKPSSPVNHEDFTGEYSFAIEYKGPGINYEIPRAVPINVDYIPTASVVLSSSQFSDDLSSLPVIQPIVKK
LKRVESSSELENFNELKGRIGGVESLEIKNEEDFQGYSNSSDSESVESGLSSSSGIFAVREEEEADNETQPRHGRRPSAV
TFLDPQTSNTISEEAESSQFEGESIQEMPRAERKGKKGSCYFCLKGNRFTEKEVCVVCGAKYCFDCIIRAMGTMPEGRKC
ISCIGFRIDESRRENLGKSSKVLKKLLTDSEIKSIMLHEKECEINQLPARLIYVNGDPLSRQELLMLRSCRKPPKNLKPG
QYWYDKESGFWGKEGHGPSQIVSSQLEVGGRIKRNASNGNTNVCINNREITKKELRILKLAGVPCEGRPSFWVSADGSYQ
EEGMNNGGKIWDKTRTKLACALYSLPIPSNSVRTGEEIEDGAKSVSSEQKVLHKLLLVGHKKSGTSTIFKQAKQIYKVPF
SDDERQMIKFLIQRNLYWYLSILLEGRERFEEEILMDEKSKQPVNDPSSSSAAGNENQLERKDIYSLGPKLKGFADWLLQ
VVVSGNFETIFPAATRVYGQLVEELLKDEAFQATYSRRNELEMLPRVATYFLDRAIDISSIEYDPSDNDILYAEGITLCN
SLSSMEFMFPESRQDSLLDPPYQHDLSIRYQLIRVHSSTLGENCKLLEMFDDIKIILFCVDLTDYDEFDEDDNGVLTNRM
IASKQLFESIVTHQASRGKNFLLILNKFDLFEEKIIQVPLAQCEWFVDFNPMITGRSSSSTNPTLAQRAFQYIAVKFKRL
FCSLTDKKLFVSQTTGMEPENVNAALRYAREIIKWQVDKPNISITEVSCTSVDASSFT*

Download fasta sequence.

Properties

These properties come from reactome analysis

REACTOME_REACTION: The Ligand:GPCR:Gz complex dissociates (REACT_22170), Adenylaye cyclase increases the GTPase activity of G alpha-olf (REACT_15449), G alpha (z) inhibits adenylate cyclase (REACT_19147), G alpha (13) activates Rho guanine nucleotide exchange factor 1 (p115-RhoGEF) (REACT_82461), G alpha (q) auto-inactivates by hydrolysing GTP to GDP (REACT_108363), G-protein alpha subunit is inactivated (REACT_15316), Activation of PLC beta-1/4 (REACT_91086), Dissociation of the TP:G13 complex (REACT_20559), The G alpha-olf:GDP:Adenylate cyclase complex dissociates (REACT_78239), Adenylate cyclase converts ATP into cyclic AMP (REACT_15399), Dissociation of the P2Y purinoceptor 1:Gq complex (REACT_20551), G alpha (z) inhibits adenylate cyclase (REACT_93015), GRK5 sequesters activated Gq (REACT_84764), G alpha (i) inhibits adenylate cyclase (REACT_19222), G alpha (13) activates Rho guanine nucleotide exchange factor 1 (p115-RhoGEF) (REACT_56), Galpha-olf:GTP binds to adenylate cyclase and activates it (REACT_80878), Galpha-olf:GTP binds to adenylate cyclase and activates it (REACT_106393), Dissociation of the PAR:Gq complex (REACT_23818), Inactive G alpha (q) reassociates with G beta:gamma (REACT_22425), Liganded G12/13-activating GPCRs bind inactive heterotrimeric G-protein G12/13 (REACT_22424), G alpha (q) binds to Trio family RhoGEFs (REACT_19301), Adenylate cyclase increases the GTPase activity of G alpha-olf (REACT_30005), Liganded Gq-activating GPCRs bind inactive heterotrimeric Gq (REACT_22436), Inactivation of PLC beta (REACT_15301), G alpha (q) inhibits PI3K alpha (REACT_95725), G-protein alpha subunit is inactivated (REACT_31604), Activated Adenylate cyclase catalyses cAMP synthesis (REACT_80465), Olfactory Receptor - G Protein olfactory trimer complex formation (REACT_15515), Inactivation of PLC beta (REACT_31813), Dissociation of the Gi alpha:G olf complex (REACT_107224), LARG activation by G alpha 12/13 (REACT_109073), Hydrolysis of 1-Phosphatidyl-D-myo-inositol 4,5-bisphosphate by Activated Phospholipase C Beta-1 (REACT_18383), Liganded Gz-activating GPCR acts as a GEF for Gz (REACT_83698), The Ligand:GPCR:Gi complex dissociates (REACT_22239), Dissociation of the Gi alpha:G olf complex (REACT_15384), Galpha-olf:GTP binds to adenylate cyclase and activates it (REACT_15385), Inactive G alpha (i) reassociates with G beta:gamma (REACT_22335), G-protein beta-gamma subunits rebind the alpha-GDP subunit (REACT_15387), Activation of PLC beta-1/4 (REACT_98277), Dissociation of the TP:Gq complex (REACT_20658), Dissociation of Gi/o Heterotrimeric G-protein Complex (REACT_18349), G13 activation by TP receptor (REACT_79051), GRK5 sequesters activated Gq (REACT_19325), Adenylate cyclase increases the GTPase activity of G alpha-olf (REACT_15335), G alpha (12/13) auto-inactivates by hydrolysing GTP to GDP (REACT_19123), G alpha (s) activates adenylate cyclase (REACT_34695), PLC beta-mediated PIP2 hydrolysis (REACT_80473), G alpha (12/13) auto-inactivates by hydrolysing GTP to GDP (REACT_96132), The G alpha-olf:GDP:Adenylate cyclase complex dissociates (REACT_108770), PIP2 hydrolysis (REACT_87628), G alpha (13) activates Rho guanine nucleotide exchange factor 1 (p115-RhoGEF) (REACT_32496), Gq activation by PAR (REACT_1430), PLC beta is activated by G alpha (q) (REACT_97105), G alpha (z) auto-inactivates by hydrolysing GTP to GDP (REACT_107730), Gz is a substrate for PKC (REACT_22249), PLC beta is activated by G alpha (q) (REACT_81799), G alpha (s) auto-inactivates by hydrolysing GTP to GDP (REACT_101520), PLC beta-mediated PIP2 hydrolysis (REACT_28636), Liganded Gz-activating GPCR acts as a GEF for Gz (REACT_33310), G alpha (s) auto-inactivates by hydrolysing GTP to GDP (REACT_110859), Gq activation by TP receptor (REACT_100888), Thrombin-activated PAR binds G-protein Gq (REACT_23902), Activated TP receptor binds G-proten Gq (REACT_20520), Activated P2Y purinoceptor 12 binds G-protein Gi (REACT_20523), Activated P2Y purinoceptor 1 binds G-protein Gq (REACT_20525), Dissociation of the P2Y purinoceptor 12:Gi complex (REACT_20630), G alpha (q) binds to Trio family RhoGEFs (REACT_86116), LARG activation by G alpha 12/13 (REACT_29492), Gq activation by P2Y purinoceptor 1 (REACT_20636), G alpha (i) auto-inactivates by hydrolysing GTP to GDP (REACT_19219), Gs activation by prostacyclin receptor (REACT_110192), The Ligand:GPCR:G12/13 complex dissociates (REACT_22264), The Ligand:GPCR:Gq complex dissociates (REACT_22263), Inactive G alpha (z) reassociates with G beta:gamma (REACT_22135), Activation of Gq by Fatty Acid Receptor 1: Fatty Acid Complex (REACT_19346), GRK2 sequesters activated Gq (REACT_84415), Liganded Gi-activating GPCRs bind inactive heterotrimeric G-protein Gi (REACT_22289), Adenylaye cyclase increases the GTPase activity of G alpha-olf (REACT_31530), Liganded Gz-activating GPCR acts as a GEF for Gz (REACT_22380), Activation of PLC beta-1/4 (REACT_15402), Dissociation of the PAR:G12/13 complex (REACT_23796), Adenylate cyclase converts ATP into cyclic AMP (REACT_110346), The high affinity receptor complex binds to G-protein (REACT_15298), Adenylate cyclase increases the GTPase activity of Gi alpha (REACT_84312), G alpha (s) activates adenylate cyclase (REACT_95192), G-protein alpha subunit is inactivated (REACT_34480), Liganded Gq/11-activating GPCRs act as GEFs for Gq/11 (REACT_15291), PIP2 hydrolysis (REACT_104013), G alpha (q) auto-inactivates by hydrolysing GTP to GDP (REACT_19186), Gq activation by TP receptor (REACT_20511), G alpha (z) inhibits adenylate cyclase (REACT_88242), PIP2 hydrolysis (REACT_15353), G alpha (q) binds to Trio family RhoGEFs (REACT_91138), The receptor:G-protein complex binds GTP (REACT_15491), PLC beta-mediated PIP2 hydrolysis (REACT_960), Adenylate cyclase increases the GTPase activity of Gi alpha (REACT_15495), The receptor:G-protein complex dissociates (REACT_15336), G12/13 activation by PAR (REACT_637), G Protein trimer formation (olfactory) (REACT_15416), Activation of Gq by Muscarinic Acetylcholine Receptor M3 (REACT_18309), PLC beta is activated by G alpha (q) (REACT_19270), Activation of Phospholipase C Beta by Gq alpha (REACT_18418), Gi activation by P2Y purinoceptor 12 (REACT_20507), G alpha (z) auto-inactivates by hydrolysing GTP to GDP (REACT_19178), Activated TP receptor binds G-protein G13 (REACT_20501), G alpha (q) inhibits PI3K alpha (REACT_19172), G alpha (q) auto-inactivates by hydrolysing GTP to GDP (REACT_81664), Liganded G12/13-activating GPCR acts as a GEF for G12/13 (REACT_22370), Liganded Gi-activating GPCR acts as a GEF for Gi (REACT_34343), G-protein alpha subunit is inactivated (REACT_83403), Inactive G alpha (12/13) reassociates with G beta:gamma (REACT_22368), G alpha (z) auto-inactivates by hydrolysing GTP to GDP (REACT_95550), Activated Adenylate cyclase catalyses cAMP synthesis (REACT_30354), LARG binds plexin B1 (REACT_19360), The G alpha-olf:GDP:Adenylate cyclase complex dissociates (REACT_15547), The receptor:G-protein complex releases GDP (REACT_15549), Inactivation of PLC beta (REACT_87892), G alpha-olf:GTP binds to Gi alpha1:GTP:adenylate cyclase complex (REACT_105297), Opsins that act as GEFs for G alpha-t (REACT_18400), Dissociation of Gq alpha:GTP Complex from G beta:G gamma Complex (REACT_18316), Activation of Gi/o Heterotrimeric G Proteins by Alpha Adrenergic Receptors Alpha-2A/2C (REACT_18311), Adenylaye cyclase increases the GTPase activity of G alpha-olf (REACT_108825), Liganded Gz-activating GPCRs bind inactive heterotrimeric G-protein Gz (REACT_22150), GRK2 sequesters activated Gq (REACT_19213), GRK5 sequesters activated Gq (REACT_100374), LARG activation by G alpha 12/13 (REACT_19158), Adenylate cyclase converts ATP into cyclic AMP (REACT_104211), Thrombin-activated PAR binds G-protein G12/13 (REACT_23839), p115-RhoGEF activation of Rac1 (REACT_1214), G alpha-olf:GTP binds to Gi alpha1:GTP:adenylate cyclase complex (REACT_15435), Liganded Gi-activating GPCR acts as a GEF for Gi (REACT_15538), G13 activation by TP receptor (REACT_20567), G alpha (z) auto-inactivates by hydrolysing GTP to GDP (REACT_82856), p115-RhoGEF activation of Rac1 (REACT_33674), G alpha (12/13) auto-inactivates by hydrolysing GTP to GDP (REACT_78069).

biological_process: synaptic transmission, transmembrane transport, cellular response to glucagon stimulus, inhibition of adenylate cyclase activity by G-protein signaling pathway, regulation of insulin secretion, energy reserve metabolic process, water transport, blood coagulation, platelet activation, activation of adenylate cyclase activity by G-protein signaling pathway.

REACTOME_COMPLEX: TP receptor:Thromboxane A2:G-protein Gq (active) [plasma membrane] (REACT_20944), ADP:P2Y purinoceptor 1:G-protein Gq (inactive) [plasma membrane] (REACT_21114), G-protein alpha (i): GTP [plasma membrane] (REACT_19580), Opioid:MOR:G-protein complex [plasma membrane] (REACT_15585), Activated PLC beta 1/4 [plasma membrane] (REACT_15568), G-protein alpha (q):GRK2 [plasma membrane] (REACT_19587), ADP:P2Y purinoceptor 12:G-protein Gi (active) [plasma membrane] (REACT_20967), Heterotrimeric G-protein G12 (inactive) [plasma membrane] (REACT_5832), G-protein alpha:GDP [plasma membrane] (REACT_17952), Ligand:GPCR complexes that activate Gq/11:Heterotrimeric G-protein Gq (active) [plasma membrane] (REACT_22589), PLC beta:G alpha (q/11) [plasma membrane] (REACT_17363), Ligand:GPCR complexes that activate Gi:Heterotrimeric G-protein Gi (active) [plasma membrane] (REACT_23190), TP receptor:Thromboxane A2:G-protein Gq (inactive) [plasma membrane] (REACT_20867), (Gi alpha1:GDP:Adenylate cyclase):(G alpha-olf:GDP) [plasma membrane] (REACT_15896), G-protein alpha (z):GDP [plasma membrane] (REACT_20097), Ligand:GPCR complexes that activate G12/13:Heterotrimeric G-protein G12/13 (active). [plasma membrane] (REACT_22602), G Protein Trimer Complex (olfactory) [plasma membrane] (REACT_15768), Heterotrimeric G-protein Gq/11 (inactive) [plasma membrane] (REACT_5130), G-protein alpha (12):GTP [plasma membrane] (REACT_5043), Ligand:GPCR complexes that activate Gi:Heterotrimeric G-protein Gi (inactive) [plasma membrane] (REACT_22813), G-protein alpha (i):GDP [plasma membrane] (REACT_19806), G alpha-olf:GTP [plasma membrane] (REACT_16015), G protein-GTP [plasma membrane] (REACT_15745), G(q) alpha: GTP Complex (pancreatic beta cell) [plasma membrane] (REACT_18564), (Gi alpha1:GTP:Adenylate cyclase):(G alpha-olf:GTP) [plasma membrane] (REACT_15996), G-protein i/o alpha:GTP:G-protein beta:G-protein gamma Complex [plasma membrane] (REACT_18596), G-protein alpha (i):GTP:Adenylate cyclase [plasma membrane] (REACT_19914), G protein alpha:GTP complex [plasma membrane] (REACT_17389), G-alpha(t)-GTP [plasma membrane] (REACT_18710), G-protein alpha (q/11):PI3K alpha [plasma membrane] (REACT_20202), G-protein i/o alpha:GDP:G-protein beta:G-protein gamma Complex [plasma membrane] (REACT_18744), Phospholipase C Beta: G(q) Complex [plasma membrane] (REACT_18449), G-protein alpha (q/11):GDP [plasma membrane] (REACT_3769), ADP:P2Y purinoceptor 12:G-protein Gi (inactive) [plasma membrane] (REACT_21024), G-protein alpha (13):GDP [plasma membrane] (REACT_17165), Heterotrimeric G-protein G12 (active) [plasma membrane] (REACT_5245), Ligand:GPCR complexes that activate G12/13:Heterotrimeric G-protein G12/13 (inactive). [plasma membrane] (REACT_23035), G(q) alpha:GTP: G beta: G gamma Complex (pancreatic beta cell) [plasma membrane] (REACT_18484), G protein alpha:GDP complex [plasma membrane] (REACT_17462), Thrombin activated PAR:G12/13 (active) [plasma membrane] (REACT_17549), Thrombin-activated PAR:Gq (inactive) [plasma membrane] (REACT_17676), ADP:P2Y prurinoceptor 1:G-protein Gq (active) [plasma membrane] (REACT_20825), Ligand:GPCR complexes that activate Gz:Heterotrimeric G-protein Gz (active) [plasma membrane] (REACT_22976), Heterotrimeric G-protein Gz (active) [plasma membrane] (REACT_23379), G-protein alpha (q/11):Trio family RhoGEFs [plasma membrane] (REACT_19870), G-protein alpha (q):GRK5 [plasma membrane] (REACT_19592), Thrombin-activated PAR:Gq (active) [plasma membrane] (REACT_17562), Gustducin Complex (alpha, beta, gamma subunits) [plasma membrane] (REACT_24604), Ligand:GPCR complexes that activate Gz:Heterotrimeric G-protein Gz (inactive) [plasma membrane] (REACT_23143), G-protein alpha (q/11): GTP [plasma membrane] (REACT_5863), G13-activated p115-RhoGEF [plasma membrane] (REACT_3301), OR - G Protein Trimer Complex [plasma membrane] (REACT_17238), Heterotrimeric G-protein G13 (inactive) [plasma membrane] (REACT_17830), G-alpha(t)-GDP [plasma membrane] (REACT_18975), G alpha-olf:GDP complex [plasma membrane] (REACT_17352), G-protein alpha (z):GTP:Adenylate cyclase [plasma membrane] (REACT_19687), p(S27)-G protein alpha (z):GTP [plasma membrane] (REACT_22530), G-protein alpha (13):GTP [plasma membrane] (REACT_18118), Heterotrimeric G-protein Gq (active) [plasma membrane] (REACT_5824), G-protein alpha (12/13):LARG:Plexin B1 [plasma membrane] (REACT_19937), Thrombin activated PAR:G12/13 (inactive) [plasma membrane] (REACT_18059), Heterotrimeric G-protein [plasma membrane] (REACT_17846), TP receptor:Thromboxane A2:G-protein G13 (inactive) [plasma membrane] (REACT_20823), G-protein alpha (12):GDP [plasma membrane] (REACT_2575), Ligand:GPCR complexes that activate Gq/11:Heterotrimeric G-protein Gq (inactive) [plasma membrane] (REACT_22865), G(q) alpha: GDP Complex (pancreatic beta cell) [plasma membrane] (REACT_23125), Heterotrimeric G-protein Gz (inactive) [plasma membrane] (REACT_22728), Opioid:MOR:G protein-GDP complex [plasma membrane] (REACT_15815), Heterotrimeric G-protein G13 (active) [plasma membrane] (REACT_17395), G-protein alpha (z):GTP [plasma membrane] (REACT_20258), G-protein alpha (12/13):LARG [plasma membrane] (REACT_19624), G protein-GDP complex [plasma membrane] (REACT_15793), G(q):GDP: G beta: G gamma Complex (pancreatic beta cell) [plasma membrane] (REACT_18540), G-alpha(t)-GDP:G-beta-gamma [plasma membrane] (REACT_18859), Opioid:MOR:G protein-GTP complex [plasma membrane] (REACT_15831), Heterotrimeric G-protein Gi (active) [plasma membrane] (REACT_20744), G alpha-olf:GDP:Adenylate cyclase (active) complex [plasma membrane] (REACT_15796), Heterotrimeric G-protein Gi (inactive) [plasma membrane] (REACT_20935), G-protein alpha i/o:GTP Complex [plasma membrane] (REACT_18504), (Gi alpha1:GTP:Adenylate cyclase):(G alpha-olf:GDP) [plasma membrane] (REACT_15853), G-protein alpha i/o:GDP Complex [plasma membrane] (REACT_18857), TP receptor:Thromboxane A2:G-protein G13 (active) [plasma membrane] (REACT_20781), G alpha-olf:GTP:Adenylate cyclase (active) complex [plasma membrane] (REACT_17212).

REACTOME_PATHWAY: ADP signalling through P2Y purinoceptor 1 (REACT_19140), Thrombin signalling through proteinase activated receptors (PARs) (REACT_21384), Adenylate cyclase activating pathway (REACT_15312), ADP signalling through P2Y purinoceptor 12 (REACT_20653), G alpha (z) signalling events (REACT_91871), G alpha (12/13) signalling events (REACT_85741), G-protein mediated events (REACT_15526), G-protein mediated events (REACT_99045), Thromboxane signalling through TP receptor (REACT_20647), Inhibition of Insulin Secretion by Adrenaline/Noradrenaline (REACT_18339), Aquaporin-mediated transport (REACT_83369), G alpha (z) signalling events (REACT_19333), G-protein activation (REACT_15457), Transmembrane transport of small molecules (REACT_102897), PLC beta mediated events (REACT_80001), Hemostasis (REACT_92318), Diabetes pathways (REACT_15380), G alpha (i) signalling events (REACT_19231), Glucagon signaling in metabolic regulation (REACT_97918), Platelet homeostasis (REACT_81787), Signaling by GPCR (REACT_92902), Opioid Signalling (REACT_106208), Regulation of Water Balance by Renal Aquaporins (REACT_107038), Hemostasis (REACT_604), Adenylate cyclase inhibitory pathway (REACT_15333), G alpha (i) signalling events (REACT_82176), G alpha (z) signalling events (REACT_101356), G alpha (q) signalling events (REACT_18283), Transmission across Chemical Synapses (REACT_105301), Platelet Activation (REACT_88667), Aquaporin-mediated transport (REACT_32279), Adenylate cyclase activating pathway (REACT_99513), G alpha (q) signalling events (REACT_94531), G alpha (z) signalling events (REACT_29998), Inhibition of adenylate cyclase pathway (REACT_29125), Glucagon signaling in metabolic regulation (REACT_83177), Integration of energy metabolism (REACT_1505), Opioid Signalling (REACT_106868), Signal amplification (REACT_20524), Regulation of Insulin Secretion by Fatty Acids Bound to GPR40 (FFAR1) (REACT_19193), Adenylate cyclase activating pathway (REACT_79509), G alpha (s) signalling events (REACT_81642), Integration of energy metabolism (REACT_89538), Platelet activation triggers (REACT_622), Activation of GABAB receptors (REACT_25330), Formation of Platelet plug (REACT_104262), Opioid Signalling (REACT_15295), G-protein mediated events (REACT_81829), G alpha (s) signalling events (REACT_105431), GPCR downstream signaling (REACT_89233), Signaling by GPCR (REACT_81368), GPCR downstream signaling (REACT_19184), GABA B receptor activation (REACT_25031), Olfactory Signaling Pathway (REACT_15488), G-protein activation (REACT_85891), GABA receptor activation (REACT_25199), Regulation of Insulin Secretion by Free Fatty Acids (REACT_19375), Integration of energy metabolism (REACT_31409), G-protein activation (REACT_83156), Platelet activation triggers (REACT_78872), Transmembrane transport of small molecules (REACT_86409), Prostacyclin signalling through prostacyclin receptor (REACT_90454), GPCR downstream signaling (REACT_90453), Activation of GABAB receptors (REACT_87363), Formation of Platelet plug (REACT_20), Neuroransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell (REACT_15370), Signaling by GPCR (REACT_14797), Signal amplification (REACT_107520), PLC beta mediated events (REACT_30626), Signaling by GPCR (REACT_83331), PLC beta mediated events (REACT_15426), G alpha (q) signalling events (REACT_78862), Transmission across Chemical Synapses (REACT_13477), Regulation of Insulin Secretion by Acetylcholine (REACT_18405), G alpha (12/13) signalling events (REACT_18407), PKA activation in glucagon signalling (REACT_80338), G alpha (12/13) signalling events (REACT_107383), GABA B receptor activation (REACT_37805), Thromboxane signalling through TP receptor (REACT_32234), GPCR downstream signaling (REACT_81307), GABA receptor activation (REACT_32964), Synaptic Transmission (REACT_13685), PKA activation in glucagon signalling (REACT_109694), Neuroransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell (REACT_92810), Adenylate cyclase inhibitory pathway (REACT_104417), Platelet Activation (REACT_798), Opioid Signalling (REACT_32504), G alpha (i) signalling events (REACT_87312), Regulation of Water Balance by Renal Aquaporins (REACT_99705), Inhibition of adenylate cyclase pathway (REACT_25282), Regulation of Insulin Secretion (REACT_18325), G-protein activation (REACT_85866), Synaptic Transmission (REACT_29595).

These properties come from phylome analysis

molecular_function: GTP binding, signal transducer activity.

cellular_component: nucleus.

biological_process: regulation of root morphogenesis, response to mannitol stimulus, response to fructose stimulus, response to glucose stimulus, response to sucrose stimulus, response to abscisic acid stimulus, G-protein coupled receptor protein signaling pathway.

These properties come from blast2go analysis

molecular_function: guanyl nucleotide binding.

biological_process: signaling.

Locations

Located in CM3.5_scaffold00050 from 2340515 to 2345617.

This polypeptide in other databases

In PhylomeDB is Phy003MGKG_CUCME .

Related features