Polypeptide MELO3C022094P1
Accession: MELO3C022094P1
Name: MELO3C022094P1
Description: Similar to T-complex protein 1 subunit zeta (Bos taurus) (uniprot_sprot:sp|Q3MHL7|TCPZ_BOVIN)
Sequence:
>MELO3C022094P1 Similar to T-complex protein 1 subunit zeta (Bos taurus) (uniprot_sprot:sp|Q3MHL7|TCPZ_BOVIN) MSLRVLNPNAEVLNKSAALHMNINAAKGLQDVLKSNLGPKGTIKMLVGGAGDIKLTKDGNTLLKEMQIQNPTAIMIARTA VAQDDTSGDGTTSTVIFIGELMKQSERYIDEGMHPRVLVDGFEIAKRATLQFLEKFKTPIVVGDEPDTEILKMVARTTLR TKLYEALADQLTDIVVNAVLCIRKPEEAIDLFMVEIMHMRHKFDVDTRLVEGLVLDHGSRHPDMKRRAENCYILTSNVSL EYDKSEVNAGFFYSNAEQREAMVAAERRQVDERVKKIIELKNKVCAGTDKNFVVINQKGIDPPSLDLLAREGIIALRRAK RRNMERLVLACGGEAVNSVENLTPDCLGWAGLVYEHVLGEEKYTFVENVKNPHSCTILIKGPNDHTIAQIKDAVRDGLRA VKNTIEDESVVMGAGSFEVAARQYLVNEVKKTVQGRAQLGVEAFADALLVVPKTLAENSGLDTQDVLIALKGAHDRGNIV GLSQHTGEPIDPQMEGIFDNYSVKRQIINSGPVIASQLLLVDEVIRAGRNMRKPT*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: unfolded protein binding, ATP binding.
cellular_component: cytoplasm.
biological_process: protein folding.
These properties come from reactome analysis
REACTOME_REACTION: Hydrolysis of ATP and release of folded actin from CCT/TriC (REACT_16915), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_91786), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_82740), Hydrolysis of ATP and release of folded actin from CCT/TriC (REACT_29657), Association of CCT/TriC with sphingosine kinase 1 (REACT_30990), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_95060), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_99841), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_87725), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_89562), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_79699), Hydrolysis of ATP and release of tubulin folding intermediate from CCT/TriC (REACT_105093), Association of CCT/TriC with sphingosine kinase 1 (REACT_79248), Hydrolysis of ATP and release of folded actin from CCT/TriC (REACT_78266), Hydrolysis of ATP and release of folded actin from CCT/TriC (REACT_106704), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_110464), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_16909), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_110891), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_105754), Association of CCT/TriC with sphingosine kinase 1 (REACT_103156), Association of CCT/TriC with sphingosine kinase 1 (REACT_16980), Association of CCT/TriC with other substrates during biosynthesis (unknown chaperone) (REACT_16984), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_111017), Hydrolysis of ATP and release of tubulin folding intermediate from CCT/TriC (REACT_17032), Exchange of ADP for ATP in CCT/TriC:actin complex (REACT_17011), Association of CCT/TriC with sphingosine kinase 1 (REACT_106470), Hydrolysis of ATP and release of tubulin folding intermediate from CCT/TriC (REACT_34756), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_33435), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_100652), ADP is exchanged for ATP in the (ADP:CCT/TriC):tubulin complex (REACT_32597), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_109317), Actin/tubulin:prefoldin complex associates with CCT/TriC (REACT_16961).
biological_process: chaperone mediated protein folding independent of cofactor, 'de novo' posttranslational protein folding, cellular protein metabolic process, protein folding.
REACTOME_COMPLEX: CCT/TriC (ADP) associated actin [cytosol] (REACT_17090), CCT/TriC(ATP):unfolded tubulin complex [cytosol] (REACT_17889), CCT/TriC:substrate complex [cytosol] (REACT_17268), CCT/TriC(ATP)-associated actin [cytosol] (REACT_17160), actin/tubulin-bound CCT/TriC(ADP) [cytosol] (REACT_17195), CCT/TriC(ADP)-associated non-native tubulin [cytosol] (REACT_17102), CCT/TriC(ATP) [cytosol] (REACT_17683), CCT/TriC(ADP) [cytosol] (REACT_17874), CCT/TriC(ADP):Sphingosine kinase 1 [cytosol] (REACT_18085).
REACTOME_PATHWAY: Association of TriC/CCT with target proteins during biosynthesis (REACT_29094), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_16936), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_78563), Protein folding (REACT_16952), Association of TriC/CCT with target proteins during biosynthesis (REACT_31856), Formation of tubulin folding intermediates by CCT/TriC (REACT_16956), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_87227), Folding of actin by CCT/TriC (REACT_84125), Protein folding (REACT_90475), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_93325), Chaperonin-mediated protein folding (REACT_104912), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_17029), Chaperonin-mediated protein folding (REACT_17004), Metabolism of proteins (REACT_91052), Protein folding (REACT_100416), Folding of actin by CCT/TriC (REACT_86026), Chaperonin-mediated protein folding (REACT_100411), Folding of actin by CCT/TriC (REACT_91038), Protein folding (REACT_34382), Metabolism of proteins (REACT_85873), Folding of actin by CCT/TriC (REACT_88264), Chaperonin-mediated protein folding (REACT_30906), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_91371), Formation of tubulin folding intermediates by CCT/TriC (REACT_98132), Association of TriC/CCT with target proteins during biosynthesis (REACT_16907), Formation of tubulin folding intermediates by CCT/TriC (REACT_77963), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_110445), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_80983), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_94344), Protein folding (REACT_85464), Formation of tubulin folding intermediates by CCT/TriC (REACT_81155), Formation of tubulin folding intermediates by CCT/TriC (REACT_86318), Association of TriC/CCT with target proteins during biosynthesis (REACT_32002), Metabolism of proteins (REACT_86658), Metabolism of proteins (REACT_99179), Folding of actin by CCT/TriC (REACT_95493), Cooperation of Prefoldin and TriC/CCT in actin and tubulin folding (REACT_101105), Metabolism of proteins (REACT_17015), Chaperonin-mediated protein folding (REACT_106927), Formation of tubulin folding intermediates by CCT/TriC (REACT_107029), Folding of actin by CCT/TriC (REACT_17050), Chaperonin-mediated protein folding (REACT_32155), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_34237), Association of TriC/CCT with target proteins during biosynthesis (REACT_97707), Prefoldin mediated transfer of substrate to CCT/TriC (REACT_81425), Metabolism of proteins (REACT_102155), Protein folding (REACT_30135).
These properties come from phylome analysis
molecular_function: ATPase activity, uncoupled, ATPase activity, unfolded protein binding, ATP binding.
cellular_component: microtubule associated complex, chaperonin-containing T-complex, lipid particle, cytoplasm.
biological_process: hermaphrodite genitalia development, locomotion, growth, cytoplasmic microtubule organization, embryo development ending in birth or egg hatching, determination of adult lifespan, centriole replication, mitosis, mitotic spindle organization, nematode larval development, protein folding.
These properties come from kegg analysis
KEGG_ORTHOLOGS: T-complex protein 1 subunit zeta (K09498).
This polypeptide in other databases
In PhylomeDB is Phy003A9UU_CUCME .