Polypeptide MELO3C022266P1
Accession: MELO3C022266P1
Name: MELO3C022266P1
Description: Similar to Putative uncharacterized protein (Cucumis melo subsp. melo) (uniref90:UniRef90_E5GCN1)
Sequence:
>MELO3C022266P1 Similar to Putative uncharacterized protein (Cucumis melo subsp. melo) (uniref90:UniRef90_E5GCN1) MQPGDIPLYPSMPAMAPLPVSMPLPGTLLVSEPGHTVTGKRRREDDLIVSNSDASDVSAPKRQAKAHDVLFRIVVPSKQI GKVIGKVGCRIQKVREETKATIKIADAVARYEERVIIISSKDNENSVTDAEKALQQIAALILKEDGSSIEELKVGTGHVA ANTIRLLIAGSQAGSLIGASGQNIEKLRNSSGASITILAPNQLPLCASAHESDRVVQISGDILAVLKALEEIGNQLRS*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: RNA binding.
These properties come from reactome analysis
REACTOME_REACTION: Lariat Formation and 5-Splice Site Cleavage (REACT_28087), Interaction of PCBP2 with MAVS/IPS-1 (REACT_24967), Formation of the Spliceosomal A Complex (REACT_788), Formation of the Spliceosomal E complex (REACT_222), Formation of an intermediate Spliceosomal C complex (REACT_625), Formation of the active Spliceosomal C complex (REACT_1554), Recruitment of AIP4 and K-48 ubiquitination of MAVS/IPS-1 (REACT_25398), Formation of an intermediate Spliceosomal C complex (REACT_108009), Formation of Exon Junction Complex (REACT_92827), Formation of the Spliceosomal B Complex (REACT_48), Formation of Exon Junction Complex (REACT_774), Formation of pre-mRNPs (REACT_1877), Formation of the active Spliceosomal C complex (REACT_89446), Formation of the Spliceosomal B Complex (REACT_90182), Lariat Formation and 5-Splice Site Cleavage (REACT_1935), Cleavage at the 3-Splice Site and Exon Ligation (REACT_1331).
biological_process: RNA splicing, gene expression, nuclear mRNA splicing, via spliceosome, negative regulation of type I interferon production, innate immune response.
REACTOME_COMPLEX: Spliceosomal A Complex [nucleoplasm] (REACT_4512), dsRNA:RIG-I/MDA5:K48 Ub-IPS-1:PCBP2:AIP4 [mitochondrial outer membrane] (REACT_26024), Exon Junction Complex [nucleoplasm] (REACT_2984), dsRNA:RIG-I/MDA5:IPS-1:PCBP2 [mitochondrial outer membrane] (REACT_25961), Spliceosomal E Complex [nucleoplasm] (REACT_4545), Spliceosomal B Complex [nucleoplasm] (REACT_3078), Spliceosomal Intermediate C Complex [nucleoplasm] (REACT_5473), Spliceosomal Active C Complex [nucleoplasm] (REACT_2680), capped, methylated pre-mRNP:CBC complex [nucleoplasm] (REACT_2736), Spliceosomal active C complex with lariat containing, 5-end cleaved pre-mRNP:CBC complex [nucleoplasm] (REACT_5191), hnRNP proteins [nucleoplasm] (REACT_9269).
REACTOME_PATHWAY: RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways (REACT_25359), mRNA Splicing - Major Pathway (REACT_91611), Negative regulators of RIG-I/MDA5 signaling (REACT_25271), mRNA Splicing - Major Pathway (REACT_467), Formation and Maturation of mRNA Transcript (REACT_2039), Innate Immunity Signaling (REACT_6802), Gene Expression (REACT_105649), Gene Expression (REACT_71), mRNA Processing (REACT_29019), mRNA Splicing (REACT_94469), Immune System (REACT_6900), Processing of Capped Intron-Containing Pre-mRNA (REACT_125), Formation and Maturation of mRNA Transcript (REACT_77979), Processing of Capped Intron-Containing Pre-mRNA (REACT_29012), mRNA Processing (REACT_1675), mRNA Splicing (REACT_1735).
These properties come from phylome analysis
molecular_function: RNA binding.
These properties come from kegg analysis
KEGG_ORTHOLOGS: heterogeneous nuclear ribonucleoprotein K (K12886).
This polypeptide in other databases
In PhylomeDB is Phy003MJCK_CUCME .
