Polypeptide MELO3C022351P1
Accession: MELO3C022351P1
Name: MELO3C022351P1
Description: Similar to RNA polymerase II C-terminal domain phosphatase-like 3 (Arabidopsis thaliana) (uniprot_sprot:sp|Q8LL04|CPL3_ARATH)
Sequence:
>MELO3C022351P1 Similar to RNA polymerase II C-terminal domain phosphatase-like 3 (Arabidopsis thaliana) (uniprot_sprot:sp|Q8LL04|CPL3_ARATH) MPSTDYLDQLLSMKGSVKEVEIHIPNGVKVKDFYSAYTDASSQLTPSNKLASDSITFGVKGKNNPNILSEGLQSGVSSIK GRGPLLPLLDLHKDHDADSLPSPTREAPTIFSVQKSGNAPTKMAFAVDGPRSHPYETDALKAVSTYQQKFGRSSFSMADR LPSPTPSEEHDGGGDIGGEVSSSSIIRSLKSSNASKPGQKSNFASNVSTGLFPNMDSSSTRVLISPLNVAPPSSVSNPTV KPLAKSRDPRLRIVNSDASAMDLNPRTMTSVQSSSILESAATLHLRKQKMDGEPNTDGPEMKRPRIGSQNLAVAASDVRA VSGSGGWLEDTIPAGPRLFNRNQMEIAEANATEKTNVTNNSGSENECTPTINNSKDASLPSLLKDIVVNPTMLLNLLKMS QQQQLAAELKLKSSEPEKNAICPTSLNPCQGSSPLINAPAVTSGILQQSAGTPSASPVVAVGRQDDLGKVRMKPRDPRRV LHGNSLQKVGSLGNDQLKGIVPTTSNTEGSRDILNGHKQDGQGDSKLASSQTLLPDIGRQFTNNLKNIADIMSVPSPPTS SQNSSSKPVGSSSMDSKPVTTASQAVDMAAPSRSQGAWGDLEHLFDSYDDKQKAAIQRERARRIEEQKKMFAARKLCLVL DLDHTLLNSAKFVEVDPVHDEILRKKEEQDREKAQRHLFRFPHMGMWTKLRPGVWNFLEKASELYELHLYTMGNKLYATE MAKVLDPKGVLFAGRVISRGDDGDPLDGDDRVPKSKDLEGVLGMESGVVIIDDSIRVWPHNKMNLIVVERYTYFPCSRRQ FGLLGPSLLEIDHDERPEDGTLASSLGVIQRIHQSFFSNPELDQVDVRTILSAEQQKILAGCRIVFSRVFPVGEANPHLH PLWQTAEQFGAQCTNQIDEQVTHVVANSLGTDKVNWALSTGRFVVHPGWVEASALLYRRATEQDFAIKP*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Abortive termination of HIV-1 elongation after arrest (REACT_6352), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6155), Abortive termination of elongation after arrest (REACT_6355), TFIIS-mediated recovery of elongation from arrest (REACT_6330), Formation of DSIF:NELF:HIV-1 early elongation complex (REACT_6357), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6358), Phosphorylation of DSIF by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6316), Addition of nucleotides leads to HIV-1 transcript elongation (REACT_6278), Hyperphosphorylation (Ser2) of RNA Pol II CTD by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6170), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6214), Pol II elongation complex moves on the HIV-1 template as transcript elongates (REACT_6158), Separation of abortive HIV-1 transcript from template (REACT_6159), Resumption of elongation after recovery from pausing (REACT_79713), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_77594), TFIIS-mediated recovery of elongation from arrest (REACT_1094), Resumption of elongation after recovery from pausing (REACT_1638), Limited elongation of the HIV-1 transcript (REACT_6192), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_93493), 7-14 nt. Backtracking of Pol II complex on the template leading to elongation arrest (REACT_1645), Formation of DSIF:NELF:early elongation complex (REACT_981), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6174), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_110194), Abortive termination of elongation after arrest (REACT_98053), Abortive termination of early transcription elongation by DSIF:NELF (REACT_989), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_2066), Hyperphosphorylation (Ser2) of RNA Pol II CTD by P-TEFb complex (REACT_6297), Resumption of elongation of HIV-1 transcript after recovery from pausing (REACT_6299), 7-14 nt. Backtracking of Pol II complex on the HIV-1 template leading to elongation arrest (REACT_6254), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_6250), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_83561), TFIIS-mediated recovery of HIV-1 elongation from arrest (REACT_6252), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_6206), Separation of elongating HIV-1 transcript from template (REACT_6204), Recruitment of elongation factors to form elongation complex (REACT_949), 2-4 nt.backtracking of Pol II complex on the HIV-1 template leading to elongation pausing (REACT_6347), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_802), Abortive termination of early transcription elongation by DSIF:NELF (REACT_89590), Abortive termination of HIV-1 elongation after arrest (Tat-containing elongation complex) (REACT_6269), Addition of nucleotides leads to transcript elongation (REACT_751), Phosphorylation of NEFL by the P-TEFb(Cyclin T1:Cdk9) complex (REACT_6311), 2-4 nt.backtracking of Pol II complex on the template leading to elongation pausing (REACT_234), Pol II elongation complex moves on the template as transcript elongates (REACT_2053), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_93340), Separation of elongating transcript from template (REACT_2030), Abortive termination of early transcription elongation by DSIF:NELF (REACT_86233), Elongating transcript encounters a lesion in the template (REACT_1138), Recruitment of elongation factors to form HIV-1 elongation complex (REACT_6275), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_79518), Abortive termination of HIV-1 early transcription elongation by DSIF:NELF (REACT_6281), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_1251), Separation of elongating transcript from template (REACT_81515), Addition of nucleotides leads to transcript elongation (REACT_107064), TFIIS-mediated recovery of elongation from arrest (REACT_102520), Pol II elongation complex moves on the template as transcript elongates (REACT_30038), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_86293).
biological_process: viral reproduction, transcription elongation from RNA polymerase II promoter, transcription from RNA polymerase II promoter, gene expression, positive regulation of viral transcription, viral transcription.
REACTOME_COMPLEX: Elongation complex prior to separation [nucleoplasm] (REACT_5853), Early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_2481), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_6594), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD and phospho-NELF [nucleoplasm] (REACT_6495), Elongation complex [nucleoplasm] (REACT_3511), DSIF:NELF:early elongation complex [nucleoplasm] (REACT_4575), HIV-1 elongation complex containing Tat [nucleoplasm] (REACT_6611), Tat-containing elongation complex prior to separation [nucleoplasm] (REACT_6548), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD ( phospho-NELF phospho DSIF) [nucleoplasm] (REACT_6633), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_6426), Paused processive elongation complex [nucleoplasm] (REACT_3066), HIV-1 early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6467), Aborted elongation complex after arrest [nucleoplasm] (REACT_6654), HIV-1 elongation complex [nucleoplasm] (REACT_6501), Elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_5512), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_5658), HIV-1 aborted elongation complex after arrest [nucleoplasm] (REACT_6471), Aborted early elongation complex [nucleoplasm] (REACT_3362), Aborted HIV-1 early elongation complex [nucleoplasm] (REACT_6695), Early elongation complex with separated aborted transcript [nucleoplasm] (REACT_6590), Arrested processive elongation complex [nucleoplasm] (REACT_4675), RNA Pol II (hypophosphorylated) complex bound to DSIF protein [nucleoplasm] (REACT_4417), HIV-1 Tat-containing aborted elongation complex after arrest [nucleoplasm] (REACT_6602), Processive elongation complex [nucleoplasm] (REACT_3018), HIV-1 arrested processive elongation complex [nucleoplasm] (REACT_6609), DSIF:NELF:early elongation complex after limited nucleotide addition [nucleoplasm] (REACT_6432), RNA Pol II (hypophosphorylated):capped pre-mRNA complex [nucleoplasm] (REACT_6382), HIV-1 paused processive elongation complex [nucleoplasm] (REACT_6459), HIV-1 Tat-containing arrested processive elongation complex [nucleoplasm] (REACT_6532), HIV-1 processive elongation complex [nucleoplasm] (REACT_6579), Tat-containing early elongation complex with hyperphosphorylated Pol II CTD [nucleoplasm] (REACT_6536), P-TEFb(Cyclin T1:Cdk9)-containing elongation complex with separated and uncleaved transcript [nucleoplasm] (REACT_6686), HIV-1 Tat-containing processive elongation complex [nucleoplasm] (REACT_6452), HIV-1 Tat-containing paused processive elongation complex [nucleoplasm] (REACT_6389).
REACTOME_PATHWAY: Formation of the HIV-1 Early Elongation Complex (REACT_6319), HIV-1 Transcription Elongation (REACT_6274), Transcription of the HIV genome (REACT_6233), RNA Polymerase II Transcription (REACT_99950), Formation of RNA Pol II elongation complex (REACT_1845), Pausing and recovery of elongation (REACT_769), RNA Polymerase II Pre-transcription Events (REACT_99660), Formation and Maturation of mRNA Transcript (REACT_96378), Transcription (REACT_1788), Transcription (REACT_87991), Formation and Maturation of mRNA Transcript (REACT_92291), Pausing and recovery of elongation (REACT_83577), Gene Expression (REACT_71), Formation of HIV-1 elongation complex in the absence of HIV-1 Tat (REACT_22201), HIV-1 elongation arrest and recovery (REACT_6259), RNA Polymerase II Transcription (REACT_1366), Elongation arrest and recovery (REACT_79615), RNA Polymerase II Transcription Elongation (REACT_833), HIV Life Cycle (REACT_6256), Formation of the Early Elongation Complex (REACT_846), Abortive elongation of HIV-1 transcript in the absence of Tat (REACT_6261), Gene Expression (REACT_98256), Formation of HIV-1 elongation complex containing HIV-1 Tat (REACT_6346), Tat-mediated HIV-1 elongation arrest and recovery (REACT_6344), Pausing and recovery of Tat-mediated HIV-1 elongation (REACT_6143), RNA Polymerase II Transcription (REACT_106213), Formation and Maturation of mRNA Transcript (REACT_2039), Transcription (REACT_34268), RNA Polymerase II Pre-transcription Events (REACT_22107), Gene Expression (REACT_108313), Tat-mediated elongation of the HIV-1 transcript (REACT_6162), RNA Polymerase II Transcription (REACT_97471), RNA Polymerase II Pre-transcription Events (REACT_82104), Elongation arrest and recovery (REACT_1892), RNA Polymerase II Transcription Elongation (REACT_107633), RNA Polymerase II Transcription Elongation (REACT_81750), Formation of the Early Elongation Complex (REACT_29380), HIV Infection (REACT_6185), Transcription (REACT_93622), Formation of the Early Elongation Complex (REACT_99528), RNA Polymerase II Transcription Elongation (REACT_87946), Gene Expression (REACT_91657), Formation of the Early Elongation Complex (REACT_101279), Formation and Maturation of mRNA Transcript (REACT_32779), Late Phase of HIV Life Cycle (REACT_6361), Pausing and recovery of HIV-1 elongation (REACT_6244).
These properties come from phylome analysis
molecular_function: metal ion binding, RNA binding, protein C-terminus binding, phosphoprotein phosphatase activity.
cellular_component: nucleus.
biological_process: regulation of transcription, DNA-dependent, transcription, DNA-dependent, negative regulation of abscisic acid mediated signaling pathway, response to salt stress.
These properties come from blast2go analysis
molecular_function: protein C-terminus binding, phosphoprotein phosphatase activity.
cellular_component: nucleus.
biological_process: negative regulation of abscisic acid mediated signaling pathway, response to salt stress.
This polypeptide in other databases
In PhylomeDB is Phy003M9PH_CUCME .