Polypeptide MELO3C022369P1
Accession: MELO3C022369P1
Name: MELO3C022369P1
Description: Similar to Eukaryotic peptide chain release factor subunit 1-3 (Arabidopsis thaliana) (uniprot_sprot:sp|P35614|ERF1Z_ARATH)
Sequence:
>MELO3C022369P1 Similar to Eukaryotic peptide chain release factor subunit 1-3 (Arabidopsis thaliana) (uniprot_sprot:sp|P35614|ERF1Z_ARATH) MADAHETDKNIEIWKIKKLIKALEAARGNGTSMISLIMPPRDQISRVTKMLGDEFGTASNIKSRVNRQSVLGAITSAQQR LKLYNKVPPNGLVLYTGTIVTEDGKEKKVTIDFEPFRPINASLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTL SGNTREVLHKFSVDLPKKHGRGGQSALRFARLRMEKRHNYVRKTAELATQFFINPATSQPNVAGLILAGSADFKTELSQS DMFDPRLQAKILNVVDVSYGGENGFNQAIELSSEILSNVKFIQEKRLIGKYFEEISQDTGKYVFGVDDTLKALEMGAVEI LIVWENLDINRYVLKNASTAEIVIKHLNKEQEANQSNFRDSATSAELEVQEKMALLEWFANEYKKFGCTLEFVTNKSQEG SQFCRGFGGIGGILRYQLDIRSFDELSDGEEYDDSE*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: translation release factor activity, codon specific.
cellular_component: cytoplasm.
biological_process: translational termination.
These properties come from reactome analysis
REACTOME_REACTION: GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_227), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_716), Formation of UPF1:eRF3 Complex on mRNA with a Premature Termination Codon and No Exon Junction Complex (REACT_75917), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_389), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_29257), SMG1 Phosphorylates UPF1 (Enhanced by Exon Junction Complex) (REACT_75910), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_109127), UPF1 Binds an mRNP with a Termination Codon Preceding an Exon Junction Complex (REACT_75753), GTP bound eRF3:eRF1 complex binds the peptidyl-tRNA:mRNA:Ribosome complex (REACT_393), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_83432), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_104420), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_1654), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_81882), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_1152), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_94459).
REACTOME_PATHWAY: Eukaryotic Translation Termination (REACT_32804), Eukaryotic Translation Termination (REACT_34462), Nonsense Mediated Decay Independent of the Exon Junction Complex (REACT_75768), Nonsense-Mediated Decay (REACT_75886), Metabolism of RNA (REACT_21257), Nonsense Mediated Decay Enhanced by the Exon Junction Complex (REACT_75822), Translation (REACT_77710), Gene Expression (REACT_105649), Metabolism of proteins (REACT_86658), Metabolism of proteins (REACT_91052), Gene Expression (REACT_71), Metabolism of mRNA (REACT_20605), Eukaryotic Translation Termination (REACT_1986), Gene Expression (REACT_98256), Translation (REACT_81833), Gene Expression (REACT_108313), Metabolism of proteins (REACT_85873), Eukaryotic Translation Termination (REACT_93205), Translation (REACT_100851), Translation (REACT_1014), Metabolism of proteins (REACT_17015), Eukaryotic Translation Termination (REACT_1034).
REACTOME_COMPLEX: eRF3-GTP:eRF1:peptidyl-tRNA:mRNA:80S Ribosome Complex [cytosol] (REACT_5762), eRF3-GDP:eRF1:peptidyl-tRNA:mRNA:80S Ribosome Complex [cytosol] (REACT_5231), eRF3-GDP:eRF1:tRNA:mRNA:80S Ribosome Complex [cytosol] (REACT_4485), SMG1:Phosphorylated UPF1:EJC:Translated mRNP [cytosol] (REACT_76156), eRF3-GDP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_5057), UPF1:eRF3 Complex on Translated mRNA [cytosol] (REACT_76212), Translated mRNA Complex with Premature Termination Codon Not Preceding Exon Junction [cytosol] (REACT_76767), SMG1:UPF1:EJC:Translated mRNP [cytosol] (REACT_76647), Translated mRNA Complex with Premature Termination Codon Preceding Exon Junction [cytosol] (REACT_76510), eRF3-GDP:eRF1:80S Ribosome:mRNA:tRNA Complex [cytosol] (REACT_4303), eRF3-GTP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_4059), Phosphorylated UPF1:SMG5:SMG7:SMG6:PP2A:Translated mRNP [cytosol] (REACT_76275).
biological_process: translation, mRNA metabolic process, RNA metabolic process, gene expression, cellular protein metabolic process, translational termination.
These properties come from kegg analysis
molecular_function: translation release factor activity.
COG: Peptide chain release factor 1 (eRF1) (COG1503).
This polypeptide in other databases
In PhylomeDB is Phy003A2IC_CUCME .

