Polypeptide MELO3C022586P1

Accession: MELO3C022586P1

Name: MELO3C022586P1

Description: Similar to U6 snRNA-associated Sm-like protein LSm6 (Mus musculus) (uniprot_sprot:sp|P62313|LSM6_MOUSE)

Sequence:

>MELO3C022586P1 Similar to U6 snRNA-associated Sm-like protein LSm6 (Mus musculus) (uniprot_sprot:sp|P62313|LSM6_MOUSE)
MSIGGEKGSASTKTPADFLKSIRGRPVVVKLNSGVDYRGILACLDGYMNIAMEQTEEYVNGQLKNKYGDAFIRGNNVLYI
STSKRTLAEGSS*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: nucleic acid binding.

cellular_component: small nucleolar ribonucleoprotein complex.

These properties come from reactome analysis


REACTOME_REACTION: Binding of Lsm1-7 Complex to Deadenylated mRNA (REACT_103648).

biological_process: exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay, nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay, mRNA metabolic process, RNA metabolic process.

REACTOME_PATHWAY: Deadenylation-dependent mRNA decay (REACT_95337), Metabolism of RNA (REACT_94876), mRNA Decay by 5 to 3 Exoribonuclease (REACT_88584), Metabolism of mRNA (REACT_32511).

These properties come from phylome analysis


molecular_function: nucleic acid binding.

cellular_component: ribonucleoprotein complex.

These properties come from kegg analysis


KEGG_ORTHOLOGS: U6 snRNA-associated Sm-like protein LSm6 (K12625).

COG: Small nuclear ribonucleoprotein (snRNP) homolog (COG1958).

Locations

Located in CM3.5_scaffold00053 from 1304650 to 1307103.

This polypeptide in other databases

In PhylomeDB is Phy003ADL2_CUCME .

Related features