Polypeptide MELO3C022863P1

Accession: MELO3C022863P1

Name: MELO3C022863P1

Description: Similar to DNA repair protein complementing XP-C cells homolog (Mus musculus) (uniprot_sprot:sp|P51612|XPC_MOUSE)

Sequence:

>MELO3C022863P1 Similar to DNA repair protein complementing XP-C cells homolog (Mus musculus) (uniprot_sprot:sp|P51612|XPC_MOUSE)
MREQESILPNGIKDAGEAIPDPGGSCSQTSIDRETLANVSRVAVSKLLSRASGRCLSGMRKHALRPCDLSKSTIGKDVNL
AMDKKVTLEAERCNENVTASCSEDVDVHEVNLQNSVSEVLEDLYDSDWEDGCVQTSDGTESQPLTIEISEIQEIPDSTKR
KPIRRASAADKEITEFVHKVHLLCLLGRGRLIDRACNDPLIQAALLSLLPAHLLKISPAKQLTASSLKPLVAWMHNNFHV
RNQTRSEGSINSALAHALETHEGTSEEIAALTVVLFRALDITARFVSILDVAPIKPEAERSKCFSQDTSRSSRNIFKNST
LMVDKAEAVDKDSLTSHCLDKKDNPRKRTSGDNRESNAVNLVGKKLHVLDDLSSTTSSNCNSKPDISETFPLKNSQVQKR
KGDIEFEMQLQMALSATAVETMPRNSSINHSNEPPLNFTSPKKLKRIDNEESASSSHGISTAVGSSKEGSPLYWAEVYCN
AENLTGKWVHIDAVNMVVDGEHKVEDLAAACKTSLRYVVAFSGLGAKDVTRRYCMKWYKIEAKRVNTLWWDNVLAPLRIL
ERQAVGGTGHLEKCCIDGLREQDKLKMSDLSDNLKQKNLLDDGNQSGKSDHNVSEGLDTDRDFSLGNQFVATRDHLEDIE
LETRALTEPLPTNQQAYKNHRLYALEKWLTKYQILHPKGPVLGFCSGYPVYPRTCVQVLKTKQKWLREGLQVKSNELPVK
ELKRSIKKIKVLESEADDFDQGDSQGTIPLYGKWQLEPLQLPHAVDGIVPKNERGQVDVWSEKCLPPGTVHIRLPRVFSV
AKKLEIDYAPALVGFEFRNGRSYPIYDGIVVCSEFKDVILETYNEEAERMEAEERRQREKQAISRWYQLLSSIITRQRLN
SRYGDSENPSQVVSGIQGMHDEGNADVPSCQEDAEPFKGQQDNVSNPNMDSPSFINQEDHKHVFLLEDRIFDEKSLVVTK
RCHCGFSVQVEEL*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: XPC binds to HR23B forming a heterodimeric complex (REACT_1984), Binding of ERCC1-XPF to preincision complex (REACT_101859), 3- incision of DNA by XPG in GG-NER (REACT_81714), XPC:HR23B complex binds to damaged DNA site with lesion (REACT_1987), XPC:HR23B complex binds to damaged DNA site with lesion (REACT_99651), Binding of ERCC1-XPF to preincision complex (REACT_2163), XPC:HR23B complex binds to damaged DNA site with lesion (REACT_81159), Recruitment of repair factors to form preincision complex (REACT_1492), Formation of open bubble structure in DNA by helicases (REACT_101644), 3- incision of DNA by XPG in GG-NER (REACT_100654), Binding of ERCC1-XPF to preincision complex (REACT_99635), Formation of open bubble structure in DNA by helicases (REACT_95993), Formation of open bubble structure in DNA by helicases (REACT_1033), XPC binds to HR23B forming a heterodimeric complex (REACT_87457), XPC binds to HR23B forming a heterodimeric complex (REACT_97499), 5-incision of DNA by ERCC1-XPF in GG-NER (REACT_1311), 3- incision of DNA by XPG in GG-NER (REACT_1124).

biological_process: DNA repair, nucleotide-excision repair, nucleotide-excision repair, DNA damage removal, nucleotide-excision repair, DNA damage recognition.

REACTOME_COMPLEX: XPC:HR23B:damaged DNA complex [nucleoplasm] (REACT_3245), XPC:HR23B complex [nucleoplasm] (REACT_4017), pre-incision complex in GG-NER [nucleoplasm] (REACT_5795), incision complex for GG-NER [nucleoplasm] (REACT_5159), Incision complex with 3-incised damaged DNA [nucleoplasm] (REACT_5099), pre-incision complex with open DNA bubble [nucleoplasm] (REACT_5689).

REACTOME_PATHWAY: Formation of incision complex in GG-NER (REACT_30166), DNA Repair (REACT_107446), Nucleotide Excision Repair (REACT_77033), DNA Damage Recognition in GG-NER (REACT_476), Nucleotide Excision Repair (REACT_1826), Global Genomic NER (GG-NER) (REACT_92144), Global Genomic NER (GG-NER) (REACT_2253), DNA Damage Recognition in GG-NER (REACT_89770), Global Genomic NER (GG-NER) (REACT_103919), Formation of incision complex in GG-NER (REACT_82554), Nucleotide Excision Repair (REACT_96106), Formation of incision complex in GG-NER (REACT_257), DNA Repair (REACT_82907), Dual incision reaction in GG-NER (REACT_311), DNA Repair (REACT_216), Dual incision reaction in GG-NER (REACT_102444), DNA Damage Recognition in GG-NER (REACT_97740), Dual incision reaction in GG-NER (REACT_90961).

These properties come from phylome analysis


molecular_function: protein binding, single-stranded DNA binding, damaged DNA binding, bubble DNA binding, loop DNA binding.

cellular_component: XPC complex, chloroplast, cytoplasm, nucleoplasm, nucleus.

biological_process: nucleotide-excision repair, nucleotide-excision repair, DNA damage removal, nucleotide-excision repair, DNA damage recognition.

These properties come from kegg analysis


KEGG_ORTHOLOGS: xeroderma pigmentosum group C-complementing protein (K10838).

Locations

Located in CM3.5_scaffold00055 from 2124559 to 2146079.

This polypeptide in other databases

In PhylomeDB is Phy003LHXL_CUCME .

Related features