Polypeptide MELO3C023124P1
Accession: MELO3C023124P1
Name: MELO3C023124P1
Description: Similar to ribonucleotide reductase 1 (A.thaliana) (tair10_pep:AT2G21790.1)
Sequence:
>MELO3C023124P1 Similar to ribonucleotide reductase 1 (A.thaliana) (tair10_pep:AT2G21790.1) MYMVKRDGRQEAVHFDKITARLKKLSYGLNIDQCDPVLVSQIVCVGVYKGIPLASLMNWPLKWLLL*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: ATP binding, protein binding, ribonucleoside-diphosphate reductase activity.
cellular_component: ribonucleoside-diphosphate reductase complex.
biological_process: oxidation-reduction process, response to cadmium ion, DNA replication.
This polypeptide in other databases
In PhylomeDB is Phy003MHBE_CUCME .

