Polypeptide MELO3C023193P2

Accession: MELO3C023193P2

Name: MELO3C023193P2

Description: Similar to Trafficking protein particle complex subunit 2 (Pongo abelii) (uniprot_sprot:sp|Q5RES6|TPPC2_PONAB)

Sequence:

>MELO3C023193P2 Similar to Trafficking protein particle complex subunit 2 (Pongo abelii) (uniprot_sprot:sp|Q5RES6|TPPC2_PONAB)
MANTACFIIVSRNNIPIYEAEVGSAVKREDSAQLHQFILHASLDIVQDLAWTTSAMFLKAVDRFNDLVVSVYVTAGHTRL
MLLHDSRNDDGIKSFFQEVHELYIKVSWTFFLLYHYCYCLWCLVCVCVCVFQQHAGECCA*

Download fasta sequence.

Properties

These properties come from blast2go analysis

cellular_component: intracellular.

biological_process: ER to Golgi vesicle-mediated transport.

These properties come from phylome analysis

molecular_function: transcription factor binding, protein binding.

cellular_component: perinuclear region of cytoplasm, TRAPP complex, Golgi apparatus, endoplasmic reticulum, intracellular.

biological_process: dsRNA transport, regulation of transcription, DNA-dependent, transcription, DNA-dependent, skeletal system development, ER to Golgi vesicle-mediated transport.

Locations

Located in CM3.5_scaffold00059 from 74864 to 75899.

This polypeptide in other databases

In PhylomeDB is Phy003MEBX_CUCME .

Related features