Polypeptide MELO3C023201P1

Accession: MELO3C023201P1

Name: MELO3C023201P1

Description: Similar to 60S ribosomal protein L34 (Nicotiana tabacum) (uniprot_sprot:sp|P41098|RL34_TOBAC)

Sequence:

>MELO3C023201P1 Similar to 60S ribosomal protein L34 (Nicotiana tabacum) (uniprot_sprot:sp|P41098|RL34_TOBAC)
MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLARNRRTVNRAYGG
VLSGSAVRERIIRAFLVEEQKIVKKVLKIQKAKEKLASKS*

Download fasta sequence.

Properties

These properties come from kegg analysis


cellular_component: cytosolic large ribosomal subunit.

COG: Ribosomal protein L34E (COG2174).

These properties come from phylome analysis


molecular_function: protein binding, RNA binding, structural constituent of ribosome.

cellular_component: ribosome, cytosolic large ribosomal subunit.

biological_process: positive regulation of growth rate, growth, endocrine pancreas development, viral transcription, embryo development ending in birth or egg hatching, determination of adult lifespan, translational termination, translational elongation, nematode larval development, translation.

These properties come from blast2go analysis


molecular_function: structural constituent of ribosome.

cellular_component: cytosolic large ribosomal subunit, plasma membrane.

biological_process: ribosome biogenesis, translation.

Locations

Located in CM3.5_scaffold00059 from 150472 to 152180.

This polypeptide in other databases

In PhylomeDB is Phy003A81O_CUCME .

Related features