Polypeptide MELO3C023297P1
Accession: MELO3C023297P1
Name: MELO3C023297P1
Sequence:
>MELO3C023297P1 MGMCVIMVEISNNLKILPLIMLVLLMSKAVGDAFNEGLYEEQAQLKGIPLLE*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: voltage-gated chloride channel activity.
cellular_component: cytoplasmic membrane-bounded vesicle, integral to membrane.
biological_process: transmembrane transport, chloride transport.
This polypeptide in other databases
In PhylomeDB is Phy003LGTH_CUCME .

