Polypeptide MELO3C023404P1

Accession: MELO3C023404P1

Name: MELO3C023404P1

Description: Similar to DNA replication complex GINS protein PSF1 (Mus musculus) (uniprot_sprot:sp|Q9CZ15|PSF1_MOUSE)

Sequence:

>MELO3C023404P1 Similar to DNA replication complex GINS protein PSF1 (Mus musculus) (uniprot_sprot:sp|Q9CZ15|PSF1_MOUSE)
MYGRKACQLVTELASGEKGQLTHFNSDLFEQVISECQQHHLELQSLIRKVQEEGLDLQTTKNEDHFGALIHHLALVRNKR
CLMAYVHNRAETIRSLIWKLLGSMIPPEIQEKLSNSEEEYFKKHSARLKEYMSKLELDLTVDMVPPKDPYIQVRVLDDIG
EGIVLSDDKTANFALHSIHFLKRTDAEQYISRGLMEELRG*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Multiple proteins are localized at replication fork (REACT_6963), Multiple proteins are localized at replication fork (REACT_83344), Multiple proteins are localized at replication fork (REACT_77137), Formation of GINS complex (REACT_6747), Multiple proteins are localized at replication fork (REACT_28298), Multiple proteins are localized at replication fork (REACT_93102), Multiple proteins are localized at replication fork (REACT_94448).

biological_process: mitotic cell cycle, DNA strand elongation involved in DNA replication, S phase of mitotic cell cycle.

REACTOME_COMPLEX: Unwinding complex at replication fork [nucleoplasm] (REACT_7007), GINS complex [nucleoplasm] (REACT_7704).

REACTOME_PATHWAY: Synthesis of DNA (REACT_29939), Synthesis of DNA (REACT_31294), DNA strand elongation (REACT_85667), DNA Replication (REACT_383), Unwinding of DNA (REACT_93501), S Phase (REACT_82813), DNA strand elongation (REACT_107311), Unwinding of DNA (REACT_91767), Cell Cycle, Mitotic (REACT_152), Unwinding of DNA (REACT_6776), Cell Cycle, Mitotic (REACT_85950), Unwinding of DNA (REACT_100553), Unwinding of DNA (REACT_98532), S Phase (REACT_81914), Synthesis of DNA (REACT_2014), Synthesis of DNA (REACT_77553), Cell Cycle, Mitotic (REACT_84794), DNA strand elongation (REACT_84115), S Phase (REACT_105829), S Phase (REACT_34043), Synthesis of DNA (REACT_29575), Cell Cycle, Mitotic (REACT_108233), DNA strand elongation (REACT_84140), DNA Replication (REACT_101785), DNA Replication (REACT_85544), S Phase (REACT_899), DNA Replication (REACT_102375), Cell Cycle, Mitotic (REACT_90846), DNA Replication (REACT_96557), Unwinding of DNA (REACT_105674), S Phase (REACT_89318), DNA strand elongation (REACT_83094), Synthesis of DNA (REACT_98237), DNA Replication (REACT_106731), DNA strand elongation (REACT_932), Cell Cycle, Mitotic (REACT_96281).

These properties come from phylome analysis


molecular_function: protein binding.

cellular_component: replication fork protection complex, DNA replication preinitiation complex, chloroplast, cytoplasm, nucleoplasm, nucleus, GINS complex.

biological_process: positive regulation of S phase of mitotic cell cycle, inductive cell migration, hermaphrodite genitalia development, body morphogenesis, embryo development ending in birth or egg hatching, cell cycle, DNA strand elongation involved in DNA replication, DNA-dependent DNA replication initiation, DNA-dependent DNA replication, DNA replication, nematode larval development, double-strand break repair via break-induced replication, S phase of mitotic cell cycle.

These properties come from kegg analysis


KEGG_ORTHOLOGS: GINS complex subunit 1 (K10732).

Locations

Located in CM3.5_scaffold00060 from 288737 to 290677.

This polypeptide in other databases

In PhylomeDB is Phy003A5B2_CUCME .

Related features