Polypeptide MELO3C023528P1
Accession: MELO3C023528P1
Name: MELO3C023528P1
Description: Similar to Histone H3.2 (Nicotiana tabacum) (uniprot_sprot:sp|Q76MV0|H32_TOBAC)
Sequence:
>MELO3C023528P1 Similar to Histone H3.2 (Nicotiana tabacum) (uniprot_sprot:sp|Q76MV0|H32_TOBAC) MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFK TDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Trimethylation of Histone H3 by PRDM9 (REACT_27242), Serum amyloid P binds DNA and chromatin (REACT_75858), HP1 alpha binds Histone H3K9(me)3 (REACT_25059), ATR Phosphorylates Histone H2A.X at Unsynapsed Regions (REACT_75904), Recruitment of ATR Kinase to Unsynapsed Regions (REACT_75923), JMJD1C demethylates H3K9 mono- and di-methylation (REACT_25371), Incorporation Of Extended And Processed Telomere End Into Higher Order T-Loop And Associated Protein Structure (REACT_8031), Recruitment of BRCA1 to Unsynapsed Regions (REACT_75884), Incorporation Of Extended And Processed Telomere End Into Associated Protein Structure (REACT_7971).
biological_process: blood coagulation, telomere maintenance.
REACTOME_COMPLEX: Extended And Processed Telomere End and Associated DNA Binding and Packaging Protein Complex [nucleoplasm] (REACT_8626), Nucleosome containing Histone H2A.x [nucleoplasm] (REACT_27840), Nucleosome with Histone H3 Dimethylated at Lysine-4 [nucleoplasm] (REACT_27650), Nucleosome (Deacetylated) [nucleoplasm] (REACT_20128), Synaptonemal:BRCA1:ATR Complex [nucleoplasm] (REACT_75938), HP1alpha:Histone H3 methylated at K9 [nucleoplasm] (REACT_27026), Unsynapsed Chromatin [nucleoplasm] (REACT_76872), Nucleosome containing Histone gamma-H2A.x [nucleoplasm] (REACT_27348), Chromatin [extracellular region] (REACT_76335), Nucleosome [nucleoplasm] (REACT_8671), Nucleosome with Deacetylated H4 and H3 Dimethylated at Lysine-9 [nucleoplasm] (REACT_23375), Meiotic D-loop Complex [nucleoplasm] (REACT_27539), Nucleosome with H3 dimethylated at lysine-9: HP1gamma Complex [nucleoplasm] (REACT_19440), Serum amyloid P-component pentamer:Double-stranded DNA [extracellular region] (REACT_76462), Nucleosome with Histone H3 Trimethylated at Lysine-4 [nucleoplasm] (REACT_27602), Synaptonemal:BRCA1 Complex [nucleoplasm] (REACT_76427), Extended And Processed Telomere End and Associated DNA Binding and Packaging Protein Complex Folded Into Higher Order Structure [nucleoplasm] (REACT_8525), Nucleosome (Deacetylated) [extracellular region] (REACT_76035), Telomere Attachment Plate [nuclear envelope, nucleoplasm] (REACT_76658), Unsynapsed Chromatin containing gamma-H2A.x [nucleoplasm] (REACT_75943), Meiotic Single-stranded DNA Complex [nucleoplasm] (REACT_27879).
REACTOME_PATHWAY: Factors involved in megakaryocyte development and platelet production (REACT_24970), Meiotic Recombination (REACT_27271), Packaging Of Telomere Ends (REACT_7963), Amyloids (REACT_75925), Hemostasis (REACT_604), Meiotic Synapsis (REACT_75792), Chromosome Maintenance (REACT_22172), Telomere Maintenance (REACT_7970).
These properties come from phylome analysis
molecular_function: DNA binding.
cellular_component: nucleus, nucleosome.
biological_process: nucleosome assembly.
These properties come from blast2go analysis
molecular_function: DNA binding.
cellular_component: nucleolus, nucleosome.
biological_process: nucleosome assembly.
This polypeptide in other databases
In PhylomeDB is Phy0039Z62_CUCME .

