Polypeptide MELO3C023548P1

Accession: MELO3C023548P1

Name: MELO3C023548P1

Description: Similar to ATP synthase subunit O, mitochondrial (Ipomoea batatas PE=1 SV=1) (uniprot_sprot:sp|P22778|ATPO_IPOBA)

Sequence:

>MELO3C023548P1 Similar to ATP synthase subunit O, mitochondrial (Ipomoea batatas PE=1 SV=1) (uniprot_sprot:sp|P22778|ATPO_IPOBA)
MAMAGRMRSIIPQFNQLLKSESQTQRSALTRALLCPTTANSEISRNYATSSKKTEAKVKVPVALFGGTGNYASALYIAAV
KANCLDKAETELLDFTEASKRSTTFSEFINDPTVRKDTRIKVINDVCAEAKFSEITNNFLALLAENGRLKYVDSISKKFQ
ELTMAHRGEVKAIVTTVIPLPAEEEKELKETLQDIIGEGKKVKLEQKIDPSILGGIVVEFGEKVFDMSIKSRAQQMERFL
REPANFDSL*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: cobalt ion binding, hydrogen ion transporting ATP synthase activity, rotational mechanism, zinc ion binding.

cellular_component: proton-transporting ATP synthase complex, catalytic core F(1), plasma membrane, mitochondrial inner membrane.

biological_process: ATP synthesis coupled proton transport.

These properties come from reactome analysis


REACTOME_REACTION: ADP and Pi bind to ATPase (REACT_991), ATP is synthesized from ADP and Pi by ATPase (REACT_190), Enzyme-bound ATP is released (REACT_1985).

REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Formation of ATP by chemiosmotic coupling (REACT_6759).

REACTOME_COMPLEX: ATPase complex [mitochondrial inner membrane] (REACT_4862), ATPase-ATP complex [mitochondrial inner membrane] (REACT_3945), ATPase-ADP and Pi complex [mitochondrial inner membrane] (REACT_2435).

biological_process: respiratory electron transport chain, mitochondrial ATP synthesis coupled proton transport.

These properties come from phylome analysis


molecular_function: hydrolase activity, cobalt ion binding, hydrogen ion transporting ATP synthase activity, rotational mechanism, zinc ion binding.

cellular_component: chloroplast, mitochondrial proton-transporting ATP synthase complex, proton-transporting ATP synthase complex, catalytic core F(1), plasma membrane, mitochondrial inner membrane.

biological_process: ATP synthesis coupled proton transport.

These properties come from kegg analysis


KEGG_ORTHOLOGS: F-type H+-transporting ATPase oligomycin sensitivity conferral protein [EC:3.6.3.14] (K02137).

molecular_function: proton-transporting ATPase activity, rotational mechanism, hydrogen ion transporting ATP synthase activity, rotational mechanism.

COG: F0F1-type ATP synthase, delta subunit (mitochondrial oligomycin sensitivity protein) (COG0712).

Locations

Located in CM3.5_scaffold00060 from 1230626 to 1234668.

This polypeptide in other databases

In PhylomeDB is Phy003MCVT_CUCME .

Related features