Polypeptide MELO3C023703P1

Accession: MELO3C023703P1

Name: MELO3C023703P1

Description: Similar to 40S ribosomal protein S4 (Solanum tuberosum) (uniprot_sprot:sp|P46300|RS4_SOLTU)

Sequence:

>MELO3C023703P1 Similar to 40S ribosomal protein S4 (Solanum tuberosum) (uniprot_sprot:sp|P46300|RS4_SOLTU)
MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRTDK
TFPAGFMDILSIPKTNENFRLLYDTKGRFRLHSVRDEEAKYKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTI
KLDLESNKIADFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIHIQDATGHEFATRLGNVFTIGKGTKPWVSLPK
GKGIKLSIIEEARKRLASQAAVTA*

Download fasta sequence.

Properties

These properties come from blast2go analysis

molecular_function: RNA binding, structural constituent of ribosome, protein binding.

cellular_component: cytosolic small ribosomal subunit.

biological_process: translation.

These properties come from reactome analysis

REACTOME_PATHWAY: Eukaryotic Translation Elongation (REACT_108858), Eukaryotic Translation Termination (REACT_94463), Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S (REACT_1258), Eukaryotic Translation Initiation (REACT_91066), Translation (REACT_1014), Formation of a pool of free 40S subunits (REACT_1797), Cap-dependent Translation Initiation (REACT_94881), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_91277), Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S (REACT_31268), Eukaryotic Translation Initiation (REACT_33969), Eukaryotic Translation Elongation (REACT_82124), Metabolism of proteins (REACT_85873), Peptide chain elongation (REACT_105694), Metabolism of proteins (REACT_91052), Eukaryotic Translation Elongation (REACT_1477), Gene Expression (REACT_85241), Peptide chain elongation (REACT_96957), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_104915), Nonsense Mediated Decay Independent of the Exon Junction Complex (REACT_75768), Diabetes pathways (REACT_106636), Translation initiation complex formation (REACT_1979), Formation of the ternary complex, and subsequently, the 43S complex (REACT_85646), Metabolism of proteins (REACT_102155), Formation of the ternary complex, and subsequently, the 43S complex (REACT_1079), Formation of a pool of free 40S subunits (REACT_102010), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_110187), Translation initiation complex formation (REACT_81317), Translation (REACT_100851), 3 -UTR-mediated translational regulation (REACT_28457), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_96420), Insulin Synthesis and Processing (REACT_15550), Metabolism of mRNA (REACT_20605), Diabetes pathways (REACT_32548), Translation (REACT_86996), Cap-dependent Translation Initiation (REACT_2099), Peptide chain elongation (REACT_32702), 3 -UTR-mediated translational regulation (REACT_1762), Formation of the ternary complex, and subsequently, the 43S complex (REACT_81478), Diabetes pathways (REACT_97252), Eukaryotic Translation Elongation (REACT_93503), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_105871), Formation of a pool of free 40S subunits (REACT_103868), Translation (REACT_105544), 3 -UTR-mediated translational regulation (REACT_31427), Metabolism of proteins (REACT_17015), Metabolism of proteins (REACT_99179), Gene Expression (REACT_91657), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_2085), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_97139), Cap-dependent Translation Initiation (REACT_110387), Ribosomal scanning and start codon recognition (REACT_33316), Cap-dependent Translation Initiation (REACT_98846), Gene Expression (REACT_108313), Insulin Synthesis and Processing (REACT_98391), Eukaryotic Translation Initiation (REACT_2159), Gene Expression (REACT_98256), Eukaryotic Translation Termination (REACT_1986), Ribosomal scanning and start codon recognition (REACT_33832), 3 -UTR-mediated translational regulation (REACT_81650), Diabetes pathways (REACT_32886), Gene Expression (REACT_71), Formation of a pool of free 40S subunits (REACT_30395), Ribosomal scanning and start codon recognition (REACT_100129), Peptide chain elongation (REACT_106978), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_28708), Nonsense-Mediated Decay (REACT_75886), Eukaryotic Translation Termination (REACT_32804), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_102684), Ribosomal scanning and start codon recognition (REACT_931), Eukaryotic Translation Elongation (REACT_81624), Diabetes pathways (REACT_15380), Gene Expression (REACT_105649), Metabolism of RNA (REACT_21257), Peptide chain elongation (REACT_1404), Eukaryotic Translation Initiation (REACT_30389), Eukaryotic Translation Initiation (REACT_77252), Eukaryotic Translation Termination (REACT_93205), Eukaryotic Translation Elongation (REACT_30678), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_79), 3 -UTR-mediated translational regulation (REACT_105496), Cap-dependent Translation Initiation (REACT_100314), Translation (REACT_81833), Formation of the ternary complex, and subsequently, the 43S complex (REACT_77868), Insulin Synthesis and Processing (REACT_78124), Formation of the ternary complex, and subsequently, the 43S complex (REACT_89669), Insulin Synthesis and Processing (REACT_98207), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_34253), Formation of a pool of free 40S subunits (REACT_107540), Eukaryotic Translation Initiation (REACT_98138), Formation of a pool of free 40S subunits (REACT_87090), Metabolism of proteins (REACT_86658), Eukaryotic Translation Termination (REACT_103749), Translation (REACT_77710), Nonsense Mediated Decay Enhanced by the Exon Junction Complex (REACT_75822), Peptide chain elongation (REACT_87004), Insulin Synthesis and Processing (REACT_92168), Diabetes pathways (REACT_106585), Cap-dependent Translation Initiation (REACT_29674), Insulin Synthesis and Processing (REACT_93978), Ribosomal scanning and start codon recognition (REACT_92962), Ribosomal scanning and start codon recognition (REACT_29174).

REACTOME_REACTION: GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_91109), eIF5B:GTP is hydrolyzed and released (REACT_88603), Signal Recognition (Preprolactin) (REACT_20565), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_1654), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_103298), eIF3 and eIF1A bind to the 40S subunit (REACT_92158), The 60S subunit joins the translation initiation complex (REACT_83133), Ribosomal scanning (REACT_105772), Hydrolysis of eEF1A:GTP (REACT_31709), eIF3 and eIF1A bind to the 40S subunit (REACT_32878), Start codon recognition (REACT_656), eIF5B:GTP is hydrolyzed and released (REACT_81139), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_29512), Hydrolysis of eEF1A:GTP (REACT_552), UPF1 Binds an mRNP with a Termination Codon Preceding an Exon Junction Complex (REACT_75753), Signal Recognition (Preprolactin) (REACT_100079), Formation of the 43S pre-initiation complex (REACT_103916), eIF2:GTP is hydrolyzed, eIFs are released (REACT_1060), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_107771), The 60S subunit joins the translation initiation complex (REACT_198), Interaction between SRP and SRP Receptor (REACT_83835), Release of 40S and 60S subunits from the 80S ribosome (REACT_100903), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_81196), The 60S subunit joins the translation initiation complex (REACT_81721), Cleavage of the Signal Peptide of Preproinsulin (REACT_15421), eIF5B:GTP is hydrolyzed and released (REACT_29113), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_78279), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_109127), The 60S subunit joins the translation initiation complex (REACT_107675), Signal Recognition (Preprolactin) (REACT_109238), Ribosomal scanning (REACT_31248), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_84975), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_2075), eIF3 and eIF1A bind to the 40S subunit (REACT_77211), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_108032), Release of 40S and 60S subunits from the 80S ribosome (REACT_107539), Start codon recognition (REACT_33398), Start codon recognition (REACT_78159), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_94459), Interaction between SRP and SRP Receptor (REACT_95183), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_81882), Interaction between SRP and SRP Receptor (REACT_15358), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_88081), Signal Recognition (Preproinsulin) (REACT_82519), Interaction between SRP and SRP Receptor (REACT_99006), Translocation of ribosome by 3 bases in the 3 direction (REACT_90731), Formation of translation initiation complexes yielding circularized Ceruloplasmin mRNA in a closed-loop conformation (REACT_1515), Ribosomal scanning (REACT_1516), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_227), Hydrolysis of eEF1A:GTP (REACT_80598), Start codon recognition (REACT_31637), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_30444), Release of 40S and 60S subunits from the 80S ribosome (REACT_77616), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_98404), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_81400), Ribosomal scanning (REACT_96533), Formation of the 43S pre-initiation complex (REACT_97597), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_31222), Signal Recognition (Preproinsulin) (REACT_89495), Formation of the 43S pre-initiation complex (REACT_1354), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_100731), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_29257), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_102180), Formation of translation initiation complexes containing mRNA that does not circularize (REACT_1904), Hydrolysis of eEF1A:GTP (REACT_31077), Association of phospho-L13a with GAIT element of Ceruloplasmin mRNA (REACT_1595), Interaction between SRP and SRP Receptor (REACT_28872), Translocation of ribosome by 3 bases in the 3 direction (REACT_93691), Hydrolysis of eEF1A:GTP (REACT_105040), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_79315), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_1227), Formation of the 43S pre-initiation complex (REACT_90953), Signal Recognition (Preprolactin) (REACT_106280), eIF3 and eIF1A bind to the 40S subunit (REACT_34386), Release of 40S and 60S subunits from the 80S ribosome (REACT_928), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_83432), eIF5B:GTP is hydrolyzed and released (REACT_102209), Start codon recognition (REACT_104947), Interaction between SRP and SRP Receptor (REACT_103640), Translocation of ribosome by 3 bases in the 3 direction (REACT_1937), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_91228), Formation of the 43S pre-initiation complex (REACT_87583), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_104420), Signal Recognition (Preproinsulin) (REACT_110574), Signal Recognition (Preprolactin) (REACT_104150), eIF3 and eIF1A bind to the 40S subunit (REACT_608), eIF5B:GTP is hydrolyzed and released (REACT_100790), The 60S subunit joins the translation initiation complex (REACT_32450), Signal Recognition (Preproinsulin) (REACT_102110), The 60S subunit joins the translation initiation complex (REACT_101966), Translocation of ribosome by 3 bases in the 3 direction (REACT_99354), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_95914), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_28090), Release of 40S and 60S subunits from the 80S ribosome (REACT_86830), Release of 40S and 60S subunits from the 80S ribosome (REACT_81831), Formation of translation initiation complexes containing mRNA that does not circularize (REACT_92483), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_81539), SMG1 Phosphorylates UPF1 (Enhanced by Exon Junction Complex) (REACT_75910), eIF5B:GTP is hydrolyzed and released (REACT_3), Formation of UPF1:eRF3 Complex on mRNA with a Premature Termination Codon and No Exon Junction Complex (REACT_75917), Ribosomal scanning (REACT_95840), Hydrolysis of eEF1A:GTP (REACT_108111), Ribosomal scanning (REACT_91084), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_15520), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_77497), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_31671), Signal Recognition (Preproinsulin) (REACT_15319), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_389).

REACTOME_COMPLEX: Elongation complex with growing peptide chain [cytosol] (REACT_5024), Preproinsulin-SRP-SRP Receptor Complex [endoplasmic reticulum membrane, cytosol] (REACT_15837), Preproinsulin-SRP Complex [cytosol] (REACT_15977), 40S:Met-tRNAi:mRNA [cytosol] (REACT_3073), 80S:aminoacyl tRNA:mRNA:eEF1A:GTP [cytosol] (REACT_5558), Phosphorylated UPF1:SMG5:SMG7:SMG6:PP2A:Translated mRNP [cytosol] (REACT_76275), 80S:Met-tRNAi:mRNA [cytosol] (REACT_4537), 40S ribosomal complex [cytosol] (REACT_5094), Preproinsulin:Ribosome Nascent Complex (translocon associated) [cytosol, endoplasmic reticulum membrane] (REACT_20998), eRF3-GDP:eRF1:80S Ribosome:mRNA:tRNA Complex [cytosol] (REACT_4303), Translated mRNA Complex with Premature Termination Codon Preceding Exon Junction [cytosol] (REACT_76510), 43S: Ceruloplasmin mRNA:eIF4F:eIF4B:eIF4H:PABP [cytosol] (REACT_3267), 80S:Met-tRNAi:mRNA:aminoacyl-tRNA [cytosol] (REACT_3365), Preprolactin Ribosome Nascent Complex [cytosol] (REACT_24551), SMG1:Phosphorylated UPF1:EJC:Translated mRNP [cytosol] (REACT_76156), Translated mRNA Complex with Premature Termination Codon Not Preceding Exon Junction [cytosol] (REACT_76767), phospho-L13a associated wth the 3 UTR GAIT element of ceruloplasmin mRNA within the translation initiation complex [cytosol] (REACT_5151), 48S complex [cytosol] (REACT_5152), Preprolactin-SRP Complex [cytosol] (REACT_21159), Preproinsulin: Ribosome Nascent Complex [cytosol] (REACT_21205), Preproinsulin-Translocon Complex [endoplasmic reticulum membrane, cytosol] (REACT_15661), UPF1:eRF3 Complex on Translated mRNA [cytosol] (REACT_76212), eRF3-GDP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_5057), 43S:mRNA:eIF4F:eIF4B:eIF4H [cytosol] (REACT_4439), 40S:eIF3:eIF1A [cytosol] (REACT_2456), 43S complex [cytosol] (REACT_3677), 80S Ribosome:mRNA Complex [cytosol] (REACT_21990), eRF3-GTP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_4059), 80S ribosome [cytosol] (REACT_4330), 80S:Met-tRNAi:mRNA:eIF5B:GTP [cytosol] (REACT_2486), SMG1:UPF1:EJC:Translated mRNP [cytosol] (REACT_76647), 80S Ribosome:mRNA:peptidyl-tRNA with elongating peptide [cytosol] (REACT_4835).

biological_process: translation, cellular protein metabolic process, RNA metabolic process, mRNA metabolic process, gene expression, translational termination, translational elongation.

These properties come from kegg analysis

cellular_component: cytosolic small ribosomal subunit.

COG: Ribosomal protein S4E (COG1471).

Locations

Located in CM3.5_scaffold00061 from 1567602 to 1570361.

This polypeptide in other databases

In PhylomeDB is Phy003A9VX_CUCME .

Related features