Polypeptide MELO3C023972P1
Accession: MELO3C023972P1
Name: MELO3C023972P1
Description: Similar to Telomerase reverse transcriptase (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q8LKW0|TERT_ORYSJ)
Sequence:
>MELO3C023972P1 Similar to Telomerase reverse transcriptase (Oryza sativa subsp. japonica) (uniprot_sprot:sp|Q8LKW0|TERT_ORYSJ) MCSFTTSDILGSLRPNFAGSESLAGYIFGSYIANGNTPSSLLFCNSGTCPFGSKCVYRSLTKLLKVLIRRSRNCQYVRLL DKHCGAPSLEQISTGNSGSMVECHRSESNTEIGEDTGGSDAIRSEDYLEAIDPQFAAKIYCPKNQVVSFIWAVCRSIVPP DMLGTCSNWRILRRNIFKFIKLRRFESFSLKQAMHQLKTSRFSFLSDKSSCCQNGRVLNSAEKRKFIESWIYWLFSHLIV PLIQAHFYVTETEFGRQDVYFFRKSIWEKLTKGATTSFKNKGYCYLNDSTVRDILKNRSFGFSKLRLCPKENGVRILANL KAYSKMPTENGGSCGGFGEKKPVEFKYYKSVNNVLRDTHAVLKGIKLKEPELLGSSVFDYNDVYQKLRLFLPGVKKAKAS MPDLFLVVSDVSNAFDSVDQDKLLDVMKTIIVKDEYHLKQYHQILCTKKTMWAHENVMLIDPNISPRFSSSQFRSLHSVL VNQERSSFVNKNDFIRILHEHVKRNVMQFDKKFYIQRTGISQGSVLSSFLCSLYFGDLERKVLFPFLGKVIASRANEVSL GQNRFDPSISPSSNVDEMITNPGYMLLRFIDDFLFISSSKLLAEKFLCRVHRGFRAYNCYMNERKFGMNFDVANTYRIVS KRVYVGKDGVSFLRWAGLLINCQTLEIQADYTKLGAIHDLILFLFVSMLYLVMIHKKLV*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: nucleotidyltransferase activity.
These properties come from reactome analysis
REACTOME_REACTION: Alignment Of The RNA Template On The Telomeric Chromosome End (REACT_7968), Recruitment of Telomerase RNP to the Telomeric Chromosome End (REACT_7960), Recruitment of Telomerase RNP to the Telomeric Chromosome End (REACT_33186), Alignment Of The RNA Template On The Telomeric Chromosome End (REACT_30646), Disassociation of Telomerase RNP and the Chromosome End (REACT_109384), Elongation Of The Telomeric Chromosome End (REACT_97770), Alignment Of The RNA Template On The Telomeric Chromosome End (REACT_86045), Translocation Of Telomerase RNP And Alignment Of RNA Template (TERC) To Extended Single Stranded Telomeric Chromosome-End (REACT_102142), Elongation of Extended Telomeric Chromosome End (REACT_77280), Biogenesis And Assembly Of The Telomerase RNP (REACT_7997), Disassociation of Telomerase RNP and the Chromosome End (REACT_7996), Elongation of Extended Telomeric Chromosome End (REACT_108407), Recruitment of Telomerase RNP to the Telomeric Chromosome End (REACT_77948), Recruitment of Telomerase RNP to the Telomeric Chromosome End (REACT_91963), Elongation of Extended Telomeric Chromosome End (REACT_84958), Translocation Of Telomerase RNP And Alignment Of RNA Template (TERC) To Extended Single Stranded Telomeric Chromosome-End (REACT_7957), Disassociation of Telomerase RNP and the Chromosome End (REACT_110379), Translocation Of Telomerase RNP And Alignment Of RNA Template (TERC) To Extended Single Stranded Telomeric Chromosome-End (REACT_93266), Elongation Of The Telomeric Chromosome End (REACT_101043), Elongation of Extended Telomeric Chromosome End (REACT_7985), Elongation Of The Telomeric Chromosome End (REACT_8019), Translocation Of Telomerase RNP And Alignment Of RNA Template (TERC) To Extended Single Stranded Telomeric Chromosome-End (REACT_105424), Alignment Of The RNA Template On The Telomeric Chromosome End (REACT_99368), Disassociation of Telomerase RNP and the Chromosome End (REACT_104898), Elongation Of The Telomeric Chromosome End (REACT_83982).
biological_process: telomere maintenance, telomere maintenance via telomerase.
REACTOME_COMPLEX: Telomerase RNP Bound and base-paired to the Telomeric Chromosome End [nucleoplasm] (REACT_8909), Telomerase RNP Bound to the Telomeric Chromosome End [nucleoplasm] (REACT_8788), Telomerase Holoenzyme Base-paired to the Telomeric Chromosome End with an Additional single Stranded Telomere repeat [nucleoplasm] (REACT_8180), Telomerase Holoenzyme:Telomeric RNP End with Two Additional Single Stranded Telomere Repeats [nucleoplasm] (REACT_8055), Telomerase RNP [nucleoplasm] (REACT_8548), Telomerase RNP:Telomeric Chromosome End with an Additional single Stranded Telomere repeat [nucleoplasm] (REACT_8663).
REACTOME_PATHWAY: Telomere Maintenance (REACT_94707), Telomere Extension By Telomerase (REACT_106788), Chromosome Maintenance (REACT_22172), Extension of Telomeres (REACT_79922), Telomere Extension By Telomerase (REACT_93468), Telomere Maintenance (REACT_78680), Extension of Telomeres (REACT_78552), Extension of Telomeres (REACT_106742), Telomere Maintenance (REACT_85782), Chromosome Maintenance (REACT_105513), Extension of Telomeres (REACT_8030), Chromosome Maintenance (REACT_94825), Telomere Extension By Telomerase (REACT_106277), Telomere Maintenance (REACT_7970), Chromosome Maintenance (REACT_90690), Telomere Extension By Telomerase (REACT_7974).
These properties come from phylome analysis
molecular_function: telomeric RNA binding, protein homodimerization activity, telomeric DNA binding, RNA binding, telomeric template RNA reverse transcriptase activity, DNA binding.
cellular_component: PML body, cytoplasm, nucleolus, telomerase holoenzyme complex, nucleoplasm, nucleus, nuclear telomere cap complex, chromosome, telomeric region, telomerase catalytic core complex.
biological_process: replicative senescence, chromosome localization, telomere formation via telomerase, DNA strand elongation, senescence (obsolete GO:0010149), telomere maintenance via telomerase, nucleolus organization, anti-apoptosis, RNA-dependent DNA replication, replicative cell aging.
These properties come from kegg analysis
KEGG_ORTHOLOGS: telomerase reverse transcriptase [EC:2.7.7.49] (K11126).
molecular_function: telomeric template RNA reverse transcriptase activity.
This polypeptide in other databases
In PhylomeDB is Phy003LMXK_CUCME .

