Polypeptide MELO3C024244P1
Accession: MELO3C024244P1
Name: MELO3C024244P1
Description: Similar to 60S ribosomal protein L37-2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q43292|RL372_ARATH)
Sequence:
>MELO3C024244P1 Similar to 60S ribosomal protein L37-2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q43292|RL372_ARATH) MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAFPAARKRKYNWSVKAIRRKTTGTGRMRYLRHVPRRFKSGFRE GTEAAPRNKGAAASA*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: rRNA binding, zinc ion binding, structural constituent of ribosome.
cellular_component: cytosolic large ribosomal subunit, plastid.
biological_process: ribosome biogenesis, translation.
These properties come from reactome analysis
REACTOME_REACTION: Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_389), Signal Recognition (Preprolactin) (REACT_104150), Signal Recognition (Preproinsulin) (REACT_15319), Release of 40S and 60S subunits from the 80S ribosome (REACT_77616), The 60S subunit joins the translation initiation complex (REACT_32450), eIF5B:GTP is hydrolyzed and released (REACT_29113), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_15520), Cleavage of the Signal Peptide of Preproinsulin (REACT_15421), Translocation of ribosome by 3 bases in the 3 direction (REACT_1937), Formation of UPF1:eRF3 Complex on mRNA with a Premature Termination Codon and No Exon Junction Complex (REACT_75917), eIF5B:GTP is hydrolyzed and released (REACT_3), SMG1 Phosphorylates UPF1 (Enhanced by Exon Junction Complex) (REACT_75910), Release of 40S and 60S subunits from the 80S ribosome (REACT_928), Interaction between SRP and SRP Receptor (REACT_15358), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_81539), The 60S subunit joins the translation initiation complex (REACT_198), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_94459), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_1227), UPF1 Binds an mRNP with a Termination Codon Preceding an Exon Junction Complex (REACT_75753), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_227), Translocation of ribosome by 3 bases in the 3 direction (REACT_93691), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_83432), Signal Recognition (Preproinsulin) (REACT_89495), Dissociation of L13a from the 60s ribosomal subunit (REACT_940), Hydrolysis of eEF1A:GTP (REACT_552), Interaction between SRP and SRP Receptor (REACT_28872), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_2075), Hydrolysis of eEF1A:GTP (REACT_31709), Dissociation of L13a from the 60s ribosomal subunit (REACT_109051), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_95914), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_103298), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_1654), Signal Recognition (Preprolactin) (REACT_20565), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_29257).
REACTOME_PATHWAY: Eukaryotic Translation Termination (REACT_32804), Nonsense Mediated Decay Independent of the Exon Junction Complex (REACT_75768), Nonsense-Mediated Decay (REACT_75886), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_105871), Insulin Synthesis and Processing (REACT_92168), Translation (REACT_1014), Nonsense Mediated Decay Enhanced by the Exon Junction Complex (REACT_75822), Translation (REACT_77710), Gene Expression (REACT_105649), 3 -UTR-mediated translational regulation (REACT_1762), Eukaryotic Translation Elongation (REACT_1477), Cap-dependent Translation Initiation (REACT_2099), Gene Expression (REACT_71), Diabetes pathways (REACT_106636), Metabolism of mRNA (REACT_20605), Peptide chain elongation (REACT_96957), Formation of a pool of free 40S subunits (REACT_107540), Eukaryotic Translation Termination (REACT_1986), Eukaryotic Translation Initiation (REACT_2159), Insulin Synthesis and Processing (REACT_15550), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_91277), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_79), Cap-dependent Translation Initiation (REACT_94881), 3 -UTR-mediated translational regulation (REACT_28457), Eukaryotic Translation Initiation (REACT_77252), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_2085), Metabolism of proteins (REACT_86658), Formation of a pool of free 40S subunits (REACT_1797), Peptide chain elongation (REACT_1404), Metabolism of RNA (REACT_21257), Metabolism of proteins (REACT_17015), Diabetes pathways (REACT_15380), Eukaryotic Translation Elongation (REACT_81624).
REACTOME_COMPLEX: 80S Ribosome:mRNA:peptidyl-tRNA with elongating peptide [cytosol] (REACT_4835), 60S ribosomal complex [cytosol] (REACT_2629), SMG1:UPF1:EJC:Translated mRNP [cytosol] (REACT_76647), Translated mRNA Complex with Premature Termination Codon Preceding Exon Junction [cytosol] (REACT_76510), 80S ribosome [cytosol] (REACT_4330), eRF3-GTP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_4059), 80S Ribosome:mRNA Complex [cytosol] (REACT_21990), 60s ribosomal complex lacking L13a subunit [cytosol] (REACT_4690), Preproinsulin-SRP Complex [cytosol] (REACT_15977), eRF3-GDP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_5057), UPF1:eRF3 Complex on Translated mRNA [cytosol] (REACT_76212), Preproinsulin-Translocon Complex [endoplasmic reticulum membrane, cytosol] (REACT_15661), Preproinsulin: Ribosome Nascent Complex [cytosol] (REACT_21205), Preprolactin-SRP Complex [cytosol] (REACT_21159), Translated mRNA Complex with Premature Termination Codon Not Preceding Exon Junction [cytosol] (REACT_76767), Preprolactin Ribosome Nascent Complex [cytosol] (REACT_24551), 80S:Met-tRNAi:mRNA:aminoacyl-tRNA [cytosol] (REACT_3365), SMG1:Phosphorylated UPF1:EJC:Translated mRNP [cytosol] (REACT_76156), eRF3-GDP:eRF1:80S Ribosome:mRNA:tRNA Complex [cytosol] (REACT_4303), Preproinsulin:Ribosome Nascent Complex (translocon associated) [cytosol, endoplasmic reticulum membrane] (REACT_20998), 80S:Met-tRNAi:mRNA [cytosol] (REACT_4537), Phosphorylated UPF1:SMG5:SMG7:SMG6:PP2A:Translated mRNP [cytosol] (REACT_76275), 80S:aminoacyl tRNA:mRNA:eEF1A:GTP [cytosol] (REACT_5558), 80S:Met-tRNAi:mRNA:eIF5B:GTP [cytosol] (REACT_2486), Preproinsulin-SRP-SRP Receptor Complex [endoplasmic reticulum membrane, cytosol] (REACT_15837), Elongation complex with growing peptide chain [cytosol] (REACT_5024).
biological_process: translational elongation, translational termination, mRNA metabolic process, RNA metabolic process, gene expression, cellular protein metabolic process, translation.
These properties come from kegg analysis
cellular_component: cytosolic large ribosomal subunit.
COG: Ribosomal protein L37E (COG2126).
This polypeptide in other databases
In PhylomeDB is Phy003A7AP_CUCME .
