Polypeptide MELO3C024435P2
Accession: MELO3C024435P2
Name: MELO3C024435P2
Description: Similar to Poly(A) polymerase (Dictyostelium discoideum) (uniprot_sprot:sp|Q54J73|PAP_DICDI)
Sequence:
>MELO3C024435P2 Similar to Poly(A) polymerase (Dictyostelium discoideum) (uniprot_sprot:sp|Q54J73|PAP_DICDI) MRFVMGSAEGLGNSPLPANQAVPKCYGVTKPISMAGPCDTDVQRNKELEKFLVDAGLYESKEESAKREEVLSRIGQIVKD WVKQLTRIKGYTDQMVEDANAVIFTFGSYRLGVHGPGADIDTLCVGPSYVNREEDFFYILHNILEEMEEVSELQPVPDAH VPVMKFKFDGISIDLLYASISCLVVPEDLDISDVSVLYNVDEPTVRSLNGCRVADQILKLVPNIENFRTSLRCLKFWAKR RGVYSNVTGFLGGVNWALLVARVCQLYPNAVPSMLLSRFFRVYTLWRWPNPVMLCAIEEDDLGCSVWDPRKNPRDRTHHM PIITPAYPCMNSSYNVSTSTLRVMMEQFQFGNKVCEEIELNKAQWSSLFEPYLFFESYKNYLQVDIVAADADDLRSWKGW VESRLRHLTLLIERKTEGKLQCHPYPHEYVDTSKPCAHCAFFMGLQRKQGELIQEGQQFDIRSSVDEFKHYTSSYMFWKP GMEIFVSHVRRRQIPPFVFPEGHRRFRASRLSALQRSDGPNQEYLQNGRSGSSERDLKRKTDPSRIEGEQNSPQKRQSIS PRRQDSVSSNISNFSNTASSERLEADIEAKTIVEKNSLCRTITRKNEELAFGGSSIGSCSSMKDSNSVESDKGSTVEIID PDKVPFNEIDHRCASNSSVITSLTSESSSCENVGFALAAGSCEGNAGSIEGSADESNNPGTSVVDSCEADSELQLDNRCI NGDSMHMETEPNAVLEMALNPGGGVKSTTIQNPVIRLSMASTA*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: protein binding, polynucleotide adenylyltransferase activity, RNA binding.
cellular_component: nucleus.
biological_process: RNA polyadenylation, transcription, DNA-dependent.
These properties come from reactome analysis
REACTOME_REACTION: Formation of an intermediate Spliceosomal C complex (REACT_625), Formation of an intermediate Spliceosomal C complex (REACT_108009), Formation of Exon Junction Complex (REACT_92827), Cleavage and polyadenylation of Intronless Pre-mRNA (REACT_108114), Cleavage of mRNA at the 3-end (REACT_1914), Lariat Formation and 5-Splice Site Cleavage (REACT_1935), Binding of Cleavage factors and Poly(A)Polymerase to the CstF:CPSF:Pre-mRNA Complex (REACT_92783), Formation of the Cleavage and Polyadenylation Complex (REACT_96214), Formation of the active Spliceosomal C complex (REACT_1554), Formation of the active Spliceosomal C complex (REACT_89446), Cleavage of Intronless Pre-mRNA at 3-end (REACT_460), Formation of the Cleavage and Polyadenylation Complex (REACT_1184), Cleavage of Intronless Pre-mRNA at 3-end (REACT_101599), Lariat Formation and 5-Splice Site Cleavage (REACT_82009), Formation of Exon Junction Complex (REACT_85923), mRNA polyadenylation (REACT_1162), Formation of Exon Junction Complex (REACT_774), Binding of Cleavage factors and Poly(A)Polymerase to the CstF:CPSF:Pre-mRNA Complex (REACT_1724), Formation of an intermediate Spliceosomal C complex (REACT_91565), Formation of the active Spliceosomal C complex (REACT_63591), Lariat Formation and 5-Splice Site Cleavage (REACT_28087), Cleavage and polyadenylation of Intronless Pre-mRNA (REACT_45), Cleavage at the 3-Splice Site and Exon Ligation (REACT_1331).
REACTOME_PATHWAY: mRNA Splicing (REACT_94469), Cleavage of Growing Transcript in the Termination Region (REACT_387), Formation and Maturation of mRNA Transcript (REACT_77979), mRNA Processing (REACT_29019), Processing of Intronless Pre-mRNAs (REACT_1096), mRNA 3-end processing (REACT_1849), Processing of Capped Intron-Containing Pre-mRNA (REACT_29012), mRNA Processing (REACT_1675), mRNA Splicing (REACT_1735), Transcription (REACT_1788), mRNA Splicing - Major Pathway (REACT_467), Processing of Capped Intronless Pre-mRNA (REACT_1768), Gene Expression (REACT_71), RNA Polymerase II Transcription (REACT_1366), Post-Elongation Processing of the Transcript (REACT_78), Post-Elongation Processing of Intronless pre-mRNA (REACT_717), Post-Elongation Processing of Intron-Containing pre-mRNA (REACT_397), RNA Polymerase II Transcription (REACT_106213), Formation and Maturation of mRNA Transcript (REACT_2039), Transcription (REACT_34268), Gene Expression (REACT_108313), Processing of Capped Intron-Containing Pre-mRNA (REACT_125), Post-Elongation Processing of the Transcript (REACT_108925), RNA Polymerase II Transcription Termination (REACT_53836), mRNA Splicing - Major Pathway (REACT_91611), Post-Elongation Processing of Intronless pre-mRNA (REACT_82898), RNA Polymerase II Transcription Termination (REACT_894), Cleavage of Growing Transcript in the Termination Region (REACT_33730), mRNA Splicing (REACT_107931), Processing of Capped Intron-Containing Pre-mRNA (REACT_82582), mRNA Splicing - Major Pathway (REACT_93740), Gene Expression (REACT_105649), Processing of Capped Intronless Pre-mRNA (REACT_33642), Formation and Maturation of mRNA Transcript (REACT_32779), mRNA Processing (REACT_80866), Processing of Intronless Pre-mRNAs (REACT_100138).
REACTOME_COMPLEX: Cleavage and Polyadenylation Complex [nucleoplasm] (REACT_3144), intronless pre-mRNA cleavage complex [nucleoplasm] (REACT_3895), 3 end cleaved, ligated exon containing complex [nucleoplasm] (REACT_3092), Ligated exon containing complex [nucleoplasm] (REACT_5472), Spliceosomal Intermediate C Complex [nucleoplasm] (REACT_5473), Exon Junction Complex [nucleoplasm] (REACT_2984), Spliceosomal Active C Complex [nucleoplasm] (REACT_2680), upstream mRNA fragment:CPSF:PAP:PABPN1 complex [nucleoplasm] (REACT_3436), Spliceosomal active C complex with lariat containing, 5-end cleaved pre-mRNP:CBC complex [nucleoplasm] (REACT_5191).
biological_process: mRNA processing, mRNA 3'-end processing, nuclear mRNA splicing, via spliceosome, transcription from RNA polymerase II promoter, RNA splicing, termination of RNA polymerase II transcription, gene expression.
These properties come from phylome analysis
molecular_function: polynucleotide adenylyltransferase activity, RNA binding.
cellular_component: nucleus.
biological_process: RNA polyadenylation, transcription, DNA-dependent.
These properties come from kegg analysis
molecular_function: polynucleotide adenylyltransferase activity.
This polypeptide in other databases
In PhylomeDB is Phy003MJ7E_CUCME .
