Polypeptide MELO3C024474P2

Accession: MELO3C024474P2

Name: MELO3C024474P2

Description: Similar to Putative uncharacterized protein (Glycine max) (uniref90:UniRef90_C6SVQ9)

Sequence:

>MELO3C024474P2 Similar to Putative uncharacterized protein (Glycine max) (uniref90:UniRef90_C6SVQ9)
MGGKCPHRSVKKRRYSHKTARRTKFLVKGDDMVYNELAKPEVERPSLPVDEDLPGMGQYYCLHCDRYFANVSVRDEHFKT
KRHRKRVKLMSGPAPHTQLDAELAAGMGMPDNGPKLMAM*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: zinc ion binding, nucleic acid binding.

cellular_component: intracellular.

These properties come from phylome analysis


molecular_function: protein binding, transcription corepressor activity, DNA binding, zinc ion binding, nucleic acid binding.

cellular_component: endoplasmic reticulum, nucleolus, nucleus, intracellular.

biological_process: positive regulation of growth rate, growth, embryo development ending in birth or egg hatching, receptor-mediated endocytosis, transcription, DNA-dependent, nematode larval development, cellular bud site selection, negative regulation of transcription from RNA polymerase II promoter, reproduction.

Locations

Located in CM3.5_scaffold00068 from 108740 to 110148.

This polypeptide in other databases

In PhylomeDB is Phy003LJ0S_CUCME .

Related features