Polypeptide MELO3C024497P1

Accession: MELO3C024497P1

Name: MELO3C024497P1

Description: Similar to Threonine dehydratase biosynthetic, chloroplastic (Solanum lycopersicum) (uniprot_sprot:sp|P25306|THD1_SOLLC)

Sequence:

>MELO3C024497P1 Similar to Threonine dehydratase biosynthetic, chloroplastic (Solanum lycopersicum) (uniprot_sprot:sp|P25306|THD1_SOLLC)
MANLPKEALESGVICASAGNHAQGVALAAGRLRTEAVIVMPRSTPPIKIEAVRSLGGNVVLHGDTFDDAQEYAQQLSKVR
NLTIIPPFDNENVIIGQGTVGMEIGRQMRGPLHAIFVPVGGGGLLAGVASFYKLVFPEVKAQLFLSVLNI*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: pyridoxal phosphate binding, L-threonine ammonia-lyase activity.

cellular_component: plastid.

biological_process: isoleucine biosynthetic process.

These properties come from phylome analysis


molecular_function: threo-3-hydroxyaspartate ammonia-lyase activity, catalytic activity, pyridoxal phosphate binding, L-threonine ammonia-lyase activity.

biological_process: cellular modified amino acid catabolic process, hermaphrodite genitalia development, locomotion, positive regulation of growth rate, cellular amino acid metabolic process, morphogenesis of an epithelium, isoleucine biosynthetic process.

Locations

Located in CM3.5_scaffold00068 from 420381 to 420952.

This polypeptide in other databases

In PhylomeDB is Phy003ME0U_CUCME .

Related features