Polypeptide MELO3C024537P2
Accession: MELO3C024537P2
Name: MELO3C024537P2
Description: Similar to Transcription initiation factor TFIID subunit 12 (Dictyostelium discoideum) (uniprot_sprot:sp|Q555L9|TAF12_DICDI)
Sequence:
>MELO3C024537P2 Similar to Transcription initiation factor TFIID subunit 12 (Dictyostelium discoideum) (uniprot_sprot:sp|Q555L9|TAF12_DICDI) MQGMQGLGMLGSSGSSSQMLHRPVQSSLRPPSTPNSASQSFQGHGLLRVPSTSSPSSSLPNTSQGMQPTNQPWLPSSSQG KPPLPTPSYRPQANSSAMQQRSHIPQQQNHPLTPVSQQQQISSAPQQQPAQSHQPQEHFAQQFQPSRSSQGLPHQQQAAR AQGPANPKASPLPPAQTNNAQASAPSRAITAEMEEPCSRILSKRSIGKLVNQIDPSERLDPEVEDILVDLAEEFVESITT FGCSLAKHRKSTTLEAKDILLHLEKNWNLTLPGFGSDEIKIFRKPLTNDTHRERLAAVKKSIVASEMASTRSSAGQAAGN TKSSLTKTPAV*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: transcription initiation factor activity, DNA binding.
cellular_component: plastid, transcription factor TFIID complex.
biological_process: transcription initiation, DNA-dependent.
These properties come from reactome analysis
REACTOME_REACTION: Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_103685), HIV-1 Promoter Opening: First Transition (REACT_6134), Newly formed phosphodiester bond stabilized and PPi released (REACT_6333), Abortive initiation after formation of the first phosphodiester bond (REACT_32630), Fall Back to Closed Pre-initiation Complex (REACT_6211), Recognition and Binding of Core Promoter Elements by TFIID (REACT_745), Binding of TFIIE to the growing preinitiation complex (REACT_1821), Addition of nucleotides 5 through 9 on the growing HIV-1 transcript (REACT_6172), RNA Polymerase II Promoter Opening: First Transition (REACT_1844), Fall Back to Closed Pre-initiation Complex (REACT_86577), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_99814), Binding of TFIIA and TFIIB to the pol II promoter:TFIID complex (REACT_266), Abortive Initiation Before Second Transition (REACT_543), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28192), Binding of TFIIE to the growing preinitiation complex (REACT_32367), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_581), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86674), Abortive Initiation Before Second Transition (REACT_106763), Binding of TFIIA and TFIIB to the pol II promoter:TFIID complex (REACT_92302), NTP Binds Active Site of RNA Polymerase II (REACT_80520), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_100578), Fall Back to Closed Pre-initiation Complex (REACT_98220), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_1684), Formation of the closed pre-initiation complex (REACT_91116), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_100344), NTP binds active site of RNA Polymerase II in HIV-1 open pre-initiation complex (REACT_6349), Fall Back to Closed Pre-initiation Complex (REACT_100253), Formation of the closed pre-initiation complex (REACT_632), Abortive HIV-1 Initiation Before Second Transition (REACT_6203), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_82574), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_85925), Abortive HIV-1 initiation after formation of the first phosphodiester bond (REACT_6226), Fall Back to Closed Pre-initiation Complex (REACT_1702), Abortive initiation after formation of the first phosphodiester bond (REACT_653), NTP Binds Active Site of RNA Polymerase II (REACT_1160), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_110236), Recognition and Binding of Core Promoter Elements by TFIID (REACT_82809), NTP Binds Active Site of RNA Polymerase II (REACT_106132), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_1467), Nucleophillic attack by 3-hydroxyl oxygen of nascent HIV-1 transcript on the Alpha phosphate of NTP (REACT_6285), Formation of the closed pre-initiation complex (REACT_105039), NTP Binds Active Site of RNA Polymerase II (REACT_80120), RNA Polymerase II Promoter Opening: First Transition (REACT_80107), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_1055), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_88546), RNA Polymerase II Promoter Opening: First Transition (REACT_93391), Formation of the closed pre-initiation complex (REACT_83351), RNA Polymerase II Promoter Opening: First Transition (REACT_89694).
biological_process: viral reproduction, transcription elongation from RNA polymerase II promoter, transcription from RNA polymerase II promoter, transcription initiation from RNA polymerase II promoter, gene expression, viral transcription.
REACTOME_COMPLEX: pol II transcription complex containing 3 Nucleotide long transcript [nucleoplasm] (REACT_3251), pol II open pre-initiation complex [nucleoplasm] (REACT_4930), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex [nucleoplasm] (REACT_2469), HIV-1 transcription complex [nucleoplasm] (REACT_6433), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF:TFIIE complex [nucleoplasm] (REACT_4404), Pol II initiation complex [nucleoplasm] (REACT_5487), Pol II Initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_2410), TFIID [nucleoplasm] (REACT_5886), HIV-1 promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex* [nucleoplasm] (REACT_6371), HIV-1 Promoter Escape Complex [nucleoplasm] (REACT_6417), HIV-1 transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_6640), pol II closed pre-initiation complex [nucleoplasm] (REACT_5734), pol II promoter:TFIID complex [nucleoplasm] (REACT_5906), pol II promoter:TFIID:TFIIA:TFIIB complex [nucleoplasm] (REACT_2339), HIV-1 open pre-initiation complex [nucleoplasm] (REACT_6605), HIV-1 closed pre-initiation complex [nucleoplasm] (REACT_6553), pol II transcription complex [nucleoplasm] (REACT_2954), HIV-1 promoter:TFIID complex [nucleoplasm] (REACT_6369), Pol II Promoter Escape Complex [nucleoplasm] (REACT_3851), pol II transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_4148), HIV-1 initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_6680), HIV-1 promoter:TFIID:TFIIA:TFIIB complex [nucleoplasm] (REACT_6531), HIV-1 initiation complex [nucleoplasm] (REACT_6518), HIV-1 transcription complex containing 3 nucleotide long transcript [nucleoplasm] (REACT_6450).
REACTOME_PATHWAY: HIV-1 Transcription Initiation (REACT_6332), RNA Polymerase II Transcription Initiation (REACT_104036), Transcription of the HIV genome (REACT_6233), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_834), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_28862), RNA Polymerase II Transcription Initiation (REACT_105389), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_85257), Formation and Maturation of mRNA Transcript (REACT_85219), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_98915), RNA Polymerase II Pre-transcription Events (REACT_99660), Gene Expression (REACT_85241), Transcription (REACT_1788), Formation and Maturation of mRNA Transcript (REACT_92291), RNA Polymerase II Pre-transcription Events (REACT_91707), Gene Expression (REACT_71), RNA Polymerase II Transcription (REACT_1366), HIV Life Cycle (REACT_6256), RNA Polymerase II HIV-1 Promoter Escape (REACT_6253), Transcription (REACT_100899), Formation and Maturation of mRNA Transcript (REACT_2039), RNA Polymerase II Transcription Initiation (REACT_1851), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_78187), RNA Polymerase II Pre-transcription Events (REACT_91410), RNA Polymerase II Transcription (REACT_97471), Formation and Maturation of mRNA Transcript (REACT_77979), Transcription (REACT_99758), RNA Polymerase II Pre-transcription Events (REACT_22107), HIV Infection (REACT_6185), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_1655), Transcription (REACT_93622), RNA Polymerase II Promoter Escape (REACT_2089), RNA Polymerase II Promoter Escape (REACT_81662), RNA Polymerase II Transcription (REACT_89454), Gene Expression (REACT_105649), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_79444), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_109232), RNA Polymerase II Transcription Initiation (REACT_88340), Gene Expression (REACT_91657), Late Phase of HIV Life Cycle (REACT_6361), RNA Polymerase II Transcription (REACT_99228).
These properties come from kegg analysis
molecular_function: general RNA polymerase II transcription factor activity.
This polypeptide in other databases
In PhylomeDB is Phy003MIJM_CUCME .

