Polypeptide MELO3C024552P2
Accession: MELO3C024552P2
Name: MELO3C024552P2
Description: Similar to Probable small nuclear ribonucleoprotein G (Arabidopsis thaliana) (uniprot_sprot:sp|O82221|RUXG_ARATH)
Sequence:
>MELO3C024552P2 Similar to Probable small nuclear ribonucleoprotein G (Arabidopsis thaliana) (uniprot_sprot:sp|O82221|RUXG_ARATH) MSRSGQPPDLKKYMDKKLQIKLNANRLVIGTLRGFDQFMNLVVDNTVEVNGNEKTDIGMVPHHLWIGNTILRLWDS*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: nucleic acid binding.
cellular_component: small nucleolar ribonucleoprotein complex.

